DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8300 and galnt11

DIOPT Version :9

Sequence 1:NP_572384.1 Gene:CG8300 / 31658 FlyBaseID:FBgn0029937 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_031759178.1 Gene:galnt11 / 448751 XenbaseID:XB-GENE-981830 Length:601 Species:Xenopus tropicalis


Alignment Length:69 Identity:20/69 - (28%)
Similarity:23/69 - (33%) Gaps:21/69 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELQSNKRMLYFSDGVMEE----------------LSSGSEDEADAEMGDKC--YDVHLNESEMPL 84
            ||...|:.|   ||.|:|                |..|....|....||..  .|.|...:||.|
 Frog   187 ELDDLKKDL---DGYMQENLSKKVKLVRNKQREGLIRGRMVGASHATGDVLVFLDSHCEVNEMWL 248

  Fly    85 GPRL 88
            .|.|
 Frog   249 QPLL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8300NP_572384.1 FAM177 30..140 CDD:291440 20/69 (29%)
galnt11XP_031759178.1 pp-GalNAc-T 147..445 CDD:133004 20/69 (29%)
Ricin_B_lectin 476..597 CDD:395527
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004847
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.