powered by:
Protein Alignment CG8300 and galnt11
DIOPT Version :9
Sequence 1: | NP_572384.1 |
Gene: | CG8300 / 31658 |
FlyBaseID: | FBgn0029937 |
Length: | 185 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031759178.1 |
Gene: | galnt11 / 448751 |
XenbaseID: | XB-GENE-981830 |
Length: | 601 |
Species: | Xenopus tropicalis |
Alignment Length: | 69 |
Identity: | 20/69 - (28%) |
Similarity: | 23/69 - (33%) |
Gaps: | 21/69 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 ELQSNKRMLYFSDGVMEE----------------LSSGSEDEADAEMGDKC--YDVHLNESEMPL 84
||...|:.| ||.|:| |..|....|....||.. .|.|...:||.|
Frog 187 ELDDLKKDL---DGYMQENLSKKVKLVRNKQREGLIRGRMVGASHATGDVLVFLDSHCEVNEMWL 248
Fly 85 GPRL 88
.|.|
Frog 249 QPLL 252
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004847 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.