DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8300 and FAM177A1

DIOPT Version :9

Sequence 1:NP_572384.1 Gene:CG8300 / 31658 FlyBaseID:FBgn0029937 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_775878.2 Gene:FAM177A1 / 283635 HGNCID:19829 Length:236 Species:Homo sapiens


Alignment Length:202 Identity:51/202 - (25%)
Similarity:90/202 - (44%) Gaps:37/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAGGLELASASGASASETDNVSALE----------LQSNKRMLYFSDG-VMEELSSGSEDEADAE 67
            ||.|...|:|.|.||.:..|....|          .:..:|:::|..| .|||.|: .|||.|  
Human    39 AASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYST-DEDEVD-- 100

  Fly    68 MGDKCYDV--HLNESEMPLGPRLRYKASRMGNRFLAGIDYVGGGLAHLLGITSSKYASELENYHR 130
             |.:..||  .::.:::..||.|.:...|.....|:..|::|..:|.:|||::.||...::.|:|
Human   101 -GLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYYR 164

  Fly   131 -AKEHGDEDLDN---------WHPRAMST----------TTSSSNNNSSGNNNRNETIVLCEPTR 175
             .||..:|:.:|         :....:.|          |..||:..:.......::.|:.|..:
Human   165 MKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQ 229

  Fly   176 SEATLPP 182
            :..::||
Human   230 NPVSVPP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8300NP_572384.1 FAM177 30..140 CDD:291440 34/123 (28%)
FAM177A1NP_775878.2 FAM177 64..167 CDD:291440 29/106 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11491
eggNOG 1 0.900 - - E1_2AEPG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5450
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1572938at2759
OrthoFinder 1 1.000 - - FOG0004847
OrthoInspector 1 1.000 - - otm42223
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31206
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5191
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.