DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8300 and Fam177a2

DIOPT Version :10

Sequence 1:NP_572384.1 Gene:CG8300 / 31658 FlyBaseID:FBgn0029937 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001093586.1 Gene:Fam177a2 / 100101807 MGIID:3714351 Length:207 Species:Mus musculus


Alignment Length:140 Identity:40/140 - (28%)
Similarity:71/140 - (50%) Gaps:17/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SAAGGLELASASGASASETDNVS------ALEL-------QSNKRMLYFSDG-VMEELSSGSEDE 63
            :|||..|.|:|: |....|..:|      .:||       :..:|:::|..| .|||.|: .|||
Mouse     8 AAAGETEAAAAT-AFRDATRQISNERGFENVELGVMGKKKKVPRRVIHFVSGETMEEYST-DEDE 70

  Fly    64 ADAEMGDKCYDVHLNESEMPLGPRLRYKASRMGNRFLAGIDYVGGGLAHLLGITSSKYASELENY 128
            .|. :..|.....::.:::..||.|.:...|.....|:..|::|..:|.:|||::.||...::.|
Mouse    71 VDG-LDKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEY 134

  Fly   129 HRAKEHGDED 138
            :|.|:..:|:
Mouse   135 YRMKKEEEEE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8300NP_572384.1 FAM177 30..142 CDD:434199 33/123 (27%)
Fam177a2NP_001093586.1 FAM177 34..149 CDD:434199 31/113 (27%)

Return to query results.
Submit another query.