DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8300 and Fam177a2

DIOPT Version :9

Sequence 1:NP_572384.1 Gene:CG8300 / 31658 FlyBaseID:FBgn0029937 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001093586.1 Gene:Fam177a2 / 100101807 MGIID:3714351 Length:207 Species:Mus musculus


Alignment Length:140 Identity:40/140 - (28%)
Similarity:71/140 - (50%) Gaps:17/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SAAGGLELASASGASASETDNVS------ALEL-------QSNKRMLYFSDG-VMEELSSGSEDE 63
            :|||..|.|:|: |....|..:|      .:||       :..:|:::|..| .|||.|: .|||
Mouse     8 AAAGETEAAAAT-AFRDATRQISNERGFENVELGVMGKKKKVPRRVIHFVSGETMEEYST-DEDE 70

  Fly    64 ADAEMGDKCYDVHLNESEMPLGPRLRYKASRMGNRFLAGIDYVGGGLAHLLGITSSKYASELENY 128
            .|. :..|.....::.:::..||.|.:...|.....|:..|::|..:|.:|||::.||...::.|
Mouse    71 VDG-LDKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEY 134

  Fly   129 HRAKEHGDED 138
            :|.|:..:|:
Mouse   135 YRMKKEEEEE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8300NP_572384.1 FAM177 30..140 CDD:291440 33/123 (27%)
Fam177a2NP_001093586.1 FAM177 35..139 CDD:291440 29/105 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845566
Domainoid 1 1.000 46 1.000 Domainoid score I12067
eggNOG 1 0.900 - - E1_2AEPG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1572938at2759
OrthoFinder 1 1.000 - - FOG0004847
OrthoInspector 1 1.000 - - oto95261
orthoMCL 1 0.900 - - OOG6_106873
Panther 1 1.100 - - LDO PTHR31206
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5191
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.710

Return to query results.
Submit another query.