DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4617 and Bap111

DIOPT Version :9

Sequence 1:NP_001259308.1 Gene:CG4617 / 31657 FlyBaseID:FBgn0029936 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_572530.1 Gene:Bap111 / 31846 FlyBaseID:FBgn0030093 Length:749 Species:Drosophila melanogaster


Alignment Length:355 Identity:71/355 - (20%)
Similarity:115/355 - (32%) Gaps:112/355 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SHLVAKDFQVTGV------SRSGRVRKKSSKLLDF----ESPDEIEKRTRRHSGARQPARYSGRG 60
            :::.||....|.|      ||.|..:.:..:.:|.    :..|:.|..|.:|...   |||    
  Fly   164 AYMSAKSKVKTDVDMHETPSRGGGSKSQHERRIDIQPAEDEDDQDEGYTTKHLAY---ARY---- 221

  Fly    61 RPSNALRDLDLDQEMLVDDGIISDSEEFHPD----TTATVVAILNSDDELDNLVQDIVDGVQAEA 121
                      |....|:::..   ||...||    .|.|.:.:|...          |..:....
  Fly   222 ----------LHNHRLINEIF---SEAVVPDVRSVVTTTRMQVLKRQ----------VSSLTMHQ 263

  Fly   122 TSQESSVRQSLYMREK--SNKRQVLKDGKVVSAKVQRKDK---GKQRYTAYSLWAKEARQKDLQD 181
            |..|:.::|   |.||  :.|:::::..:....:::|..|   .::.:....|...|..::|.|.
  Fly   264 TKLEAELQQ---MEEKFEAKKQRMVESSEAFQEELKRHCKPAVDEETFQKMVLRMYEDIKRDRQR 325

  Fly   182 LDFTSATRRLSELWANVSNRDKNTWRRKAKIEASRAK---TRDKTAANGATQPASNGSTALADAT 243
            ||              ..|.:.|:....|...|:.|.   ||.:.|....|||   |..|...|.
  Fly   326 LD--------------EPNANANSAANPAAAAATAAAAPVTRSEEAVKPPTQP---GQPAATPAG 373

  Fly   244 QHETIFQNRATTSRTRKLAADRQQSSIEAAAAAAAAAATGTNTQRRSISTRSARSQVSKSATKQA 308
            |                          |.|:|..|.||....|. .::...:.....|.:.|...
  Fly   374 Q--------------------------EPASAVPAPAAPPKETP-PAVKPATLNPTPSSTPTPAP 411

  Fly   309 QVHTDADVSGRTGGQLKQEEVQKTSIEVID 338
            .||.             .|...||..|.:|
  Fly   412 AVHV-------------HETASKTDPEPMD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4617NP_001259308.1 HMG-box 165..218 CDD:238037 10/52 (19%)
Bap111NP_572530.1 HMGB-UBF_HMG-box 95..154 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.