DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4617 and Hmgxb4

DIOPT Version :9

Sequence 1:NP_001259308.1 Gene:CG4617 / 31657 FlyBaseID:FBgn0029936 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001100882.1 Gene:Hmgxb4 / 307667 RGDID:1305783 Length:598 Species:Rattus norvegicus


Alignment Length:400 Identity:98/400 - (24%)
Similarity:157/400 - (39%) Gaps:136/400 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPTSHLVAKDFQVTGVSRSGRVRKKSSKLLDFESPDEIEKRTRRHSGA-RQPARYSGRGRPSNAL 66
            |....|.|.:..:....|..:.:|||.|  ..:..|:...:.:|||.. |...|..|..|     
  Rat   297 SSAGELEAGELVIDDSYREIKKKKKSKK--SKKKKDKDRHKEKRHSRTKRSSTREHGTAR----- 354

  Fly    67 RDLDLDQEMLVDDGIISDSEEFHPDTTATVVAI--LNSDDELDNLVQDIVDGVQAEATSQESSVR 129
                  :.|||..          |.::...:.:  |::|..                        
  Rat   355 ------EHMLVSS----------PASSIPTLPLPALHTDGH------------------------ 379

  Fly   130 QSLYMREKSNKRQVLKDGKVVSAKVQRKDKG----KQRYTAYSLWAKEARQKDLQD---LDFTSA 187
                 .||..|::         .|.:.:::|    |:..:||.::.||.|...:.|   :||...
  Rat   380 -----GEKKKKKE---------EKDRERERGEKPKKKNMSAYQVFCKEYRVTIVADHPGIDFGEL 430

  Fly   188 TRRLSELWANVSNRDKNTWRRKAKIEASRAKTRDKTAANGATQPASNGSTALADATQHETIFQNR 252
            :::|:|:|..:..:||..|::||:.                              .||:   ||:
  Rat   431 SKKLAEVWKQLPEKDKLIWKQKAQY------------------------------LQHK---QNK 462

  Fly   253 ATTSRTRKLAADRQQSSIEAAAAAAAAAATGTNTQRRSISTRSARSQVSKSATKQAQVHTDADVS 317
            |..:..:     |:.||.|......|::....:.|::|..|...                     
  Rat   463 AEATTVK-----RKASSAEGTMKVRASSVGILSPQKKSPPTTML--------------------- 501

  Fly   318 GRTGGQLKQEEVQKTSIEVIDAAAHLKLLGESLTVIGERLKKHNGYVALSGSLSVLLDSLLCAMG 382
                  |.....:....|.||.||||:||||||::||.||::..|.||:||||||||||::||:|
  Rat   502 ------LPASPAKAPETEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLDSIICALG 560

  Fly   383 PLLCMTTQIP 392
            ||.|:|||:|
  Rat   561 PLACLTTQLP 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4617NP_001259308.1 HMG-box 165..218 CDD:238037 16/55 (29%)
Hmgxb4NP_001100882.1 DUF4171 107..225 CDD:290491
HMG-box 400..463 CDD:238037 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008243
OrthoInspector 1 1.000 - - oto98255
orthoMCL 1 0.900 - - OOG6_109229
Panther 1 1.100 - - LDO PTHR46584
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.