DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4617 and hmg-4

DIOPT Version :9

Sequence 1:NP_001259308.1 Gene:CG4617 / 31657 FlyBaseID:FBgn0029936 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_498633.1 Gene:hmg-4 / 176052 WormBaseID:WBGene00001974 Length:697 Species:Caenorhabditis elegans


Alignment Length:291 Identity:56/291 - (19%)
Similarity:100/291 - (34%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RKKSSKLLDF--------------------ESPDEIEKRTRRHSGARQPARYSGRGRPSNALRDL 69
            :::::||.|:                    .|.|||:.         ..|..:..||..:...|.
 Worm   410 KEENNKLFDYLNKKNIKIRNSQRVENTVADSSDDEIDP---------YKAAVTAEGRQRDDSDDD 465

  Fly    70 DLDQEMLVDDGIISDSEEFHPDTTATVVAILNSDDELDNLVQDIVDGVQAEATSQESSVRQSLYM 134
            ..|::..:|..|....|    |..::.......|||.|:..:....|........|..|......
 Worm   466 STDEDYDLDKDIKKKKE----DKESSEGTGSEPDDEYDSGSEQDSSGTGESEPDSEQDVPSKRRK 526

  Fly   135 REKSNKRQVLKDGKVVSAKVQRKDKG----KQRYTAYSLWAKEARQKDLQDLD-FTSATRRLSEL 194
            .|...||:..:..:....|..:|||.    |:..:||..|...:|.:..:|.| .....::....
 Worm   527 GEPKEKREKKEKREKKEGKKGKKDKDPNAPKRATSAYMQWFLASRNELKEDGDSVADVAKKGGAK 591

  Fly   195 WANVSNRDKNTWRRKAKIEASR----------------------AKTRDKTAANGATQPASNGST 237
            |..:|:.||..|..||:.:.||                      :||..|::...:::..|....
 Worm   592 WKTMSSDDKKKWEEKAEEDKSRYEKEMKEYRKNGPPSSSSKPSSSKTSKKSSGPSSSKAISKEYI 656

  Fly   238 ALADATQHETIFQNRATTSRTRKLAADRQQS 268
            :.:|.:..|       ...:..|.||.:::|
 Worm   657 SDSDDSDDE-------EPKKKEKKAAPKEES 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4617NP_001259308.1 HMG-box 165..218 CDD:238037 15/75 (20%)
hmg-4NP_498633.1 SSrecog 75..285 CDD:281523
PH2_SSRP1-like 332..429 CDD:270051 3/18 (17%)
HMGB-UBF_HMG-box 556..619 CDD:238686 16/62 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.