Sequence 1: | NP_001259308.1 | Gene: | CG4617 / 31657 | FlyBaseID: | FBgn0029936 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138203.1 | Gene: | Dsp1 / 117294 | FlyBaseID: | FBgn0278608 | Length: | 397 | Species: | Drosophila melanogaster |
Alignment Length: | 267 | Identity: | 44/267 - (16%) |
---|---|---|---|
Similarity: | 90/267 - (33%) | Gaps: | 83/267 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 QAEATSQESSVRQSLYMREKSNKRQVLKDGKVVSAKVQRKDKGKQRYTAYSLWAKEARQKDL--- 179
Fly 180 --QDLDFTSATRRLSELWANVSNRDKNTWRRKAKIEASR--AKTRDKTAANGAT----------- 229
Fly 230 QP----------------------ASNGSTALAD-----------------------ATQHETIF 249
Fly 250 QNRAT---TSRTRKLAADRQQSSIEAAAAAAAAAATGTNTQRRSISTRSARSQVSKSATKQAQVH 311
Fly 312 TDADVSG 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4617 | NP_001259308.1 | HMG-box | 165..218 | CDD:238037 | 11/59 (19%) |
Dsp1 | NP_001138203.1 | HMG-box | 182..252 | CDD:294061 | 14/69 (20%) |
HMGB-UBF_HMG-box | 275..339 | CDD:238686 | 4/63 (6%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45450766 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |