DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4617 and Dsp1

DIOPT Version :9

Sequence 1:NP_001259308.1 Gene:CG4617 / 31657 FlyBaseID:FBgn0029936 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:267 Identity:44/267 - (16%)
Similarity:90/267 - (33%) Gaps:83/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 QAEATSQESSVRQSLYMREKSNKRQVLKDGKVVSAKVQRKDKGKQRYTAYSLWAKEARQKDL--- 179
            |.:...|:...:|...|:::..::.|:.....:| :|:...|.:.|.|||:.:.:..|::..   
  Fly   142 QQQQQQQQQQHQQQQQMQQQQQQQNVINSASPMS-RVKADAKPRGRMTAYAYFVQTCREEHKKKH 205

  Fly   180 --QDLDFTSATRRLSELWANVSNRDKNTWRRKAKIEASR--AKTRDKTAANGAT----------- 229
              :.:.|...:|:.:|.|..:.:::|..:...|:.:..|  |:.::.....||.           
  Fly   206 PDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNYVPPKGAVVGRGKKRKQIK 270

  Fly   230 QP----------------------ASNGSTALAD-----------------------ATQHETIF 249
            .|                      |.|....:.|                       |.:.:..:
  Fly   271 DPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARY 335

  Fly   250 QNRAT---TSRTRKLAADRQQSSIEAAAAAAAAAATGTNTQRRSISTRSARSQVSKSATKQAQVH 311
            :...|   ||....::|...|:|::|.|..||..|.....|.:.:.                :.|
  Fly   336 EREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQLE----------------EQH 384

  Fly   312 TDADVSG 318
            .|.|..|
  Fly   385 DDDDGDG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4617NP_001259308.1 HMG-box 165..218 CDD:238037 11/59 (19%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 14/69 (20%)
HMGB-UBF_HMG-box 275..339 CDD:238686 4/63 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450766
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.