DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and IZH2

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_014641.2 Gene:IZH2 / 854160 SGDID:S000005362 Length:317 Species:Saccharomyces cerevisiae


Alignment Length:252 Identity:55/252 - (21%)
Similarity:100/252 - (39%) Gaps:64/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NVITHGIWILPAV-FAAIKLFERSSSASQYLVAWV--------YGGALCMLFTVSTFFHCSCYCA 144
            |:.:|   ::||: |..:.|.::|:........|:        |.||...|. :|:.|||   ..
Yeast    82 NIYSH---LIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLI-LSSSFHC---LK 139

  Fly   145 EHKPPKNVKAWPCLGWQTYQGLKNVLHRC---DRAMIYVFIAGSYFPWLTLENTDHSAILFCMEW 206
            .|.          |...|.....:.|..|   ..:|:.:...| ||...:         |||:..
Yeast   140 SHS----------LRIATLGNKLDYLGICILIVTSMVSILYYG-YFEKFS---------LFCLFA 184

  Fly   207 VIWLMAGIG---IAYQQVFHER-YKCLETFFYLVMGLGPALVVVFTGHHFHGMMQL--------- 258
            :|.:..||.   ::.:..|.:| ::......::..||. :::.:|:|.:.:...::         
Yeast   185 LITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLS-SIIPIFSGLYCYSFSEIWTQIQLFWV 248

  Fly   259 KFGGGFYILGIVFFK-------ADGTIPM---AHAIWHLFVVLAAGCHYYAILVNLY 305
            ..||..||:|.|.:.       ..|...:   :|.::|..||:||.||...:| |.|
Yeast   249 LLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLL-NSY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 53/249 (21%)
IZH2NP_014641.2 HlyIII 74..297 CDD:397239 51/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.