DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and IZH1

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_010780.1 Gene:IZH1 / 852102 SGDID:S000002900 Length:316 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:67/273 - (24%)
Similarity:104/273 - (38%) Gaps:105/273 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QVANVITHGIWILPA----VFA-------AIKLFERSSSASQYLVAWVY--GGALCMLFTVSTFF 137
            :..|:.||   ::||    |||       .|.:|. |:|.|.|.|..::  |...|::  .|:.|
Yeast    80 ETVNIYTH---LVPAIVYFVFAITLTNYFLIPVFP-STSWSDYTVINIFLMGAFSCLM--CSSCF 138

  Fly   138 HCSCYCAEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAG-----SYFPWLTLENTDH 197
            ||....:|    |....|..|   .|.|:.::: .|  :||.:...|     |||...|:.    
Yeast   139 HCMKQHSE----KQSNFWSKL---DYLGIISLI-SC--SMIPIIYFGYFDHISYFSLFTIV---- 189

  Fly   198 SAIL--FCMEWVIWLMAGIGIAYQQVFHERYKCLETF------FYLVMGLGPALVVVFTGHHFHG 254
            :.:|  ||...|:              |:::. ..||      |:::.|             |.|
Yeast   190 TLVLATFCTVCVL--------------HDKFN-TSTFRPFRAMFFILFG-------------FSG 226

  Fly   255 MMQL-----KFG----------------GGFYILGIVF--FKADGTIP--------MAHAIWHLF 288
            ::.|     |||                ..|||.|.|.  |:...|:.        .:|.|:|:.
Yeast   227 LLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFFGSSHQIFHIM 291

  Fly   289 VVLAAGCHYYAIL 301
            |||.:.||..||:
Yeast   292 VVLGSVCHLKAII 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 67/273 (25%)
IZH1NP_010780.1 HlyIII 75..300 CDD:397239 64/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.