DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and AT1G70900

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_565005.1 Gene:AT1G70900 / 843429 AraportID:AT1G70900 Length:244 Species:Arabidopsis thaliana


Alignment Length:231 Identity:47/231 - (20%)
Similarity:68/231 - (29%) Gaps:89/231 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IEQVANVITHGIWILPAVFAAIKLFERSSSASQYLVAWVYGGALCMLFTVSTFFHCSCYCAEHKP 148
            :|..|||||.    :|.:|..::...::.:..      ||..:|..:...|:.:|.|        
plant    76 LETAANVITS----IPFIFLGMQAPRKNLNMK------VYANSLIGVGIASSLYHSS-------- 122

  Fly   149 PKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGSYFPWLTLENTDHSAILFCMEWVIWLMAG 213
              ..|....|.|..|..:........||             |..||..            :|||.
plant   123 --RGKFRKYLRWADYTMIATATICLTRA-------------LREENPK------------FLMAA 160

  Fly   214 IGIAYQQVFHERYKCLETFFYLVMGLGPALV-VVFTG-------------------HHFHGMMQL 258
            ..:|                   :...|.:| .|.||                   |..|.|..|
plant   161 SALA-------------------LPFQPLVVSAVHTGMMEVAFAKRALEDPDLKMAHDVHKMSSL 206

  Fly   259 KFGGGFYILGIVFFKADGTIPMAHAIWHLFVVLAAG 294
             .||..:|...:|.:.    |..||.|||...:..|
plant   207 -LGGALFIADDLFPET----PFIHAGWHLAAAIGVG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 47/230 (20%)
AT1G70900NP_565005.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487730at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.