DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and HHP4

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001329234.1 Gene:HHP4 / 829922 AraportID:AT4G37680 Length:390 Species:Arabidopsis thaliana


Alignment Length:256 Identity:56/256 - (21%)
Similarity:94/256 - (36%) Gaps:87/256 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EQVANVITHGIWILPAVFAAIKLFERSSSASQYLVAWVY----GGALCMLFTVSTFFHCSCYCAE 145
            |.:||:|.      |.:|..|             ..|.:    |||:..|...||....||:.  
plant   178 EDLANLIA------PLIFRPI-------------TRWPFYAFLGGAMFCLLASSTCHLLSCHS-- 221

  Fly   146 HKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGSYFPWLTLENTDHSAI---LFCMEWV 207
                              :.:..::.|.|.|.|...||.|::|     ...:|.:   .||..::
plant   222 ------------------ERVSYIMLRLDYAGIAALIATSFYP-----PVYYSFMCDPFFCNLYL 263

  Fly   208 IWL----MAGIGIAYQQVFHE-RYKCLETFFYLVM---GLGPAL--VVVF---------TGHHFH 253
            .::    :|.:.::...||.. .::.:....:..|   ||.|.|  :::|         ||:.. 
plant   264 GFITILGIATVLVSLLPVFQSPEFRVVRASLFFGMGFSGLAPILHKLIIFWDQPEALHTTGYEI- 327

  Fly   254 GMMQLKFGGGFYILGIVFFKA-------DGTIPMA---HAIWHLFVVLAAGCHYYAILVNL 304
             :|.|.:|     ||.:.:..       .|...:|   |.::|:.||..|..||.|.||.|
plant   328 -LMGLLYG-----LGALVYATRIPERWMPGKFDIAGHSHQLFHVLVVAGAFTHYRAGLVYL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 55/254 (22%)
HHP4NP_001329234.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.