powered by:
Protein Alignment CG4615 and PAQR6
DIOPT Version :9
Sequence 1: | NP_572382.1 |
Gene: | CG4615 / 31656 |
FlyBaseID: | FBgn0029935 |
Length: | 313 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024305646.1 |
Gene: | PAQR6 / 79957 |
HGNCID: | 30132 |
Length: | 551 |
Species: | Homo sapiens |
Alignment Length: | 61 |
Identity: | 16/61 - (26%) |
Similarity: | 24/61 - (39%) |
Gaps: | 12/61 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 264 FYILGIVFFKADG----TIPMAHAIWHLFVVLAAGCHYYAILVNL-------YPSEGAAAP 313
||.||:.:.:..| .:..:|. :|||..|..|..:.:.|... |..||...|
Human 295 FYRLGLCWGRGHGCGQEALSTSHG-YHLFCALLTGFLFASHLPERLAPGRFDYIGEGTPGP 354
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG4615 | NP_572382.1 |
hlyIII |
85..304 |
CDD:273425 |
12/43 (28%) |
PAQR6 | XP_024305646.1 |
HlyIII |
<276..350 |
CDD:322438 |
13/55 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.