DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and PAQR6

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_024305646.1 Gene:PAQR6 / 79957 HGNCID:30132 Length:551 Species:Homo sapiens


Alignment Length:61 Identity:16/61 - (26%)
Similarity:24/61 - (39%) Gaps:12/61 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 FYILGIVFFKADG----TIPMAHAIWHLFVVLAAGCHYYAILVNL-------YPSEGAAAP 313
            ||.||:.:.:..|    .:..:|. :|||..|..|..:.:.|...       |..||...|
Human   295 FYRLGLCWGRGHGCGQEALSTSHG-YHLFCALLTGFLFASHLPERLAPGRFDYIGEGTPGP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 12/43 (28%)
PAQR6XP_024305646.1 HlyIII <276..350 CDD:322438 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.