DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and Mmd2

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_780426.1 Gene:Mmd2 / 75104 MGIID:1922354 Length:247 Species:Mus musculus


Alignment Length:234 Identity:104/234 - (44%)
Similarity:131/234 - (55%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YQPTEIEQVANVITHGIWILPAVFAAIKLFERSSSASQYLVAWVYGGALCMLFTVSTFFHCSCYC 143
            |||||.|..||..||..||:|::..:..|:..|....:.:.||:||..||.||.|||.||...:.
Mouse    29 YQPTEYEHAANCATHAFWIIPSILGSSNLYFLSDDDWETISAWIYGLGLCGLFVVSTIFHTVSWK 93

  Fly   144 AEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGSYFPWLTLEN----TDHSAILFCM 204
            ..|                .:.:::.||..||.:||.|||.||.|||.|..    ..|      |
Mouse    94 KSH----------------LRMVEHCLHMIDRMVIYFFIAASYAPWLNLRELGPWASH------M 136

  Fly   205 EWVIWLMAGIGIAYQQVFHERYKCLETFFYLVMGLGPALVVVFTGHHFHGMMQLKFGGGFYILGI 269
            .|::|:||.||..|...||||||.:|...|:|||..||||:: :..:..|:.:|..||.||.||:
Mouse   137 RWLVWIMASIGTIYVFFFHERYKLVELLCYVVMGFFPALVIL-SMPNTDGIWELMTGGAFYCLGM 200

  Fly   270 VFFKADGTIPMAHAIWHLFVVLAAGCHYYAILVNLY-PS 307
            ||||:||.||.|||||||||...||.|||||...|| ||
Mouse   201 VFFKSDGRIPFAHAIWHLFVAFGAGTHYYAIWRYLYLPS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 95/222 (43%)
Mmd2NP_780426.1 HlyIII 35..235 CDD:296067 95/222 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4820
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I3849
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003169
OrthoInspector 1 1.000 - - otm44178
orthoMCL 1 0.900 - - OOG6_103941
Panther 1 1.100 - - LDO PTHR20855
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2564
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.