DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and Paqr8

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001342051.1 Gene:Paqr8 / 74229 MGIID:1921479 Length:354 Species:Mus musculus


Alignment Length:284 Identity:57/284 - (20%)
Similarity:97/284 - (34%) Gaps:94/284 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YQPTEIE-------------QVANVITHGIWILPAVFAAIKLFERSSSASQYLVAWVYGGAL--- 127
            |:||..|             :|.||.||   :|.|:...::.:           |:|..|||   
Mouse    55 YRPTGHEWRYYFFSLFQKHNEVVNVWTH---LLAALAVLLRFW-----------AFVEAGALQWA 105

  Fly   128 ------CMLFTVSTFFHCSCYCAEH--KPPKNVKAW-----PCLGWQTYQ---GLKNVLHRCDRA 176
                  .:||.:|:..:.:|....|  :....:..:     ..:|...||   .|.:..:..|:|
Mouse   106 SPHTLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQA 170

  Fly   177 ---MIYVFIAGSYFPWLTLENTDHSAILFCMEWVIWLMAGIGIAYQQVFHER-YKCLETFFYLV- 236
               :.::|    :.|          |..||.    ||... |..|.:..:.| |..:.....:| 
Mouse   171 WYELFWIF----FLP----------AAAFCG----WLSCA-GCCYAKYRYRRPYPVMRKICQVVP 216

  Fly   237 MGLGPALVVVFTGH-----HFHGMMQLKFGGGFYILGIVFFKADG---TIPM------------- 280
            .||...|.:....|     |..|..:.  ...::.|.|:||....   :.|:             
Mouse   217 AGLAFVLDISPVAHRVALCHLAGCQEQ--AAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVG 279

  Fly   281 -AHAIWHLFVVLAAGCHYYAILVN 303
             .|.|:|.|:.:.......|||::
Mouse   280 HGHQIFHAFLSVCTLSQLEAILLD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 54/278 (19%)
Paqr8NP_001342051.1 HlyIII 70..297 CDD:367292 50/261 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.