DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and Paqr6

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_017446590.2 Gene:Paqr6 / 681021 RGDID:1584722 Length:358 Species:Rattus norvegicus


Alignment Length:271 Identity:56/271 - (20%)
Similarity:93/271 - (34%) Gaps:87/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AKAKPGCAYQPTEIEQVANVITHGIWILPAV---FAA--IKLFERSSSASQYLVAWVYGGALCML 130
            |...||...:|..:..:       :::||..   ||:  ...|...|..::::..::..||| .|
  Rat    83 ALGSPGFHAEPYHLPLL-------VFLLPTCLYPFASCCAHTFSSMSPRARHICYFLDYGAL-SL 139

  Fly   131 FTVSTFFHCSCYCAE--------HK---PPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAG 184
            :::...|..:.|...        |:   |...:.::.|.|...|                     
  Rat   140 YSLGCAFPYAAYSMPASWLHSRLHQLFVPAAALNSFLCTGLSCY--------------------- 183

  Fly   185 SYFPWLTLENTDHSAILFCMEWVIWLMAGIGIAYQQVFHERYKCLETFFYLVMGLGPALVVVFTG 249
            |.||  .|||...|.:|          .....||..:|..    |..|:.|.:..|.|       
  Rat   184 SRFP--ELENPGLSKVL----------RTAAFAYPFLFDN----LPLFYRLRLCWGRA------- 225

  Fly   250 HHFHGMMQLKFGGGFYIL-----GIVFFK------ADGT---IPMAHAIWHLFVVLAAGCHYY-- 298
             |..|...|....|:::|     |.:|..      |.|.   |..:|.::|:..||  |.|:.  
  Rat   226 -HSCGRDALSCSHGYHLLCALLTGFLFAARLPERLAPGRFDYIGHSHQLFHICAVL--GTHFQLE 287

  Fly   299 AILVNLYPSEG 309
            |:|.::....|
  Rat   288 AVLADMGSRRG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 51/250 (20%)
Paqr6XP_017446590.2 HlyIII 58..286 CDD:397239 53/257 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.