DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and mmd2a

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001167529.1 Gene:mmd2a / 558749 ZFINID:ZDB-GENE-081104-52 Length:243 Species:Danio rerio


Alignment Length:242 Identity:99/242 - (40%)
Similarity:128/242 - (52%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KWKNAKAKPGCAYQPTEIEQVANVITHGIWILPAVFAAIKLFERSSSASQYLVAWVYGGALCMLF 131
            ::.|.:......|||||.|..||..|||.||:|::.....|...|....:.:.||:||..|..||
Zfish    13 RFMNNRVPSSKRYQPTEYEHAANCATHGFWIIPSILGGSMLHFLSDDQWETISAWMYGIGLSGLF 77

  Fly   132 TVSTFFHCSCYCAEHKPPKNVKAWPCLGWQTYQGLKNV---LHRCDRAMIYVFIAGSYFPWLTLE 193
            .:||.||...:...|                   |:.|   .|.|||.:||.|||.||.|||.|.
Zfish    78 IMSTMFHTVSWKKSH-------------------LRKVEQRFHMCDRMVIYFFIAASYAPWLNLR 123

  Fly   194 NTDHSAILFCMEWVIWLMAGIGIAYQQVFHERYKCLETFFYLVMGLGPALVVVFTGHHFHGMMQL 258
            .....|:  .|.|::|:||..|.||...|||:.|.|:...|..||..|| ||:.:..:..|:::|
Zfish   124 ELGPWAV--HMRWLVWIMACAGSAYVFFFHEKNKILDLLCYTAMGSVPA-VVLLSMPNREGVLEL 185

  Fly   259 KFGGGFYILGIVFFKADGTIPMAHAIWHLFVVLAAGCHYYAILVNLY 305
            ..||.||.||:||||:||.||.||||||:||.:.|..|||||...||
Zfish   186 SVGGLFYCLGVVFFKSDGLIPFAHAIWHVFVAVGAAIHYYAIWKYLY 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 91/221 (41%)
mmd2aNP_001167529.1 HlyIII 31..231 CDD:296067 91/221 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4790
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 197 1.000 Inparanoid score I3782
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487730at2759
OrthoFinder 1 1.000 - - FOG0003169
OrthoInspector 1 1.000 - - otm24365
orthoMCL 1 0.900 - - OOG6_103941
Panther 1 1.100 - - LDO PTHR20855
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2564
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.