DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and PAQR5

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001098024.1 Gene:PAQR5 / 54852 HGNCID:29645 Length:330 Species:Homo sapiens


Alignment Length:270 Identity:58/270 - (21%)
Similarity:89/270 - (32%) Gaps:82/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YQPTEIEQVANVITHGIWILPAVFAAIK----LFERSSSASQYLVAW---VYGGALCMLFTVSTF 136
            :|.|  .:..|:.||   :||..|.|.:    |:........|  :|   ||....|:...||:.
Human    43 FQMT--NETLNIWTH---LLPFWFFAWRFVTALYMTDIKNDSY--SWPMLVYMCTSCVYPLVSSC 100

  Fly   137 FHCSCYCAEHKPPKNVKAWPCLGWQTYQGL-KNVLHRC---DRAMIYVFIAGS------------ 185
            .|                       |:..: ||..|.|   |...:.:|..||            
Human   101 AH-----------------------TFSSMSKNARHICYFLDYGAVNLFSLGSAIAYSAYTFPDA 142

  Fly   186 --------YFPWLTLENTDHSAILFCME-----------WVIWLMAGIGIAYQQVFHERYKCLET 231
                    |:..|.:.||..|..|.|..           .||.::|   .||...    :..|..
Human   143 LMCTTFHDYYVALAVLNTILSTGLSCYSRFLEIQKPRLCKVIRVLA---FAYPYT----WDSLPI 200

  Fly   232 FFYLVMGLGPALVVVFTGHHFHGMMQLKFGGGFYILGIVFFKADGT---IPMAHAIWHLFVVLAA 293
            |:.|.:..|.:.....|.:|...|:........|...:....|.|.   |..:|.::|:.|:||.
Human   201 FYRLFLFPGESAQNEATSYHQKHMIMTLLASFLYSAHLPERLAPGRFDYIGHSHQLFHVCVILAT 265

  Fly   294 GCHYYAILVN 303
            .....|||::
Human   266 HMQMEAILLD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 56/264 (21%)
PAQR5NP_001098024.1 HlyIII 43..269 CDD:308575 55/262 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.