DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and adipor1a

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001314683.1 Gene:adipor1a / 436740 ZFINID:ZDB-GENE-040718-169 Length:375 Species:Danio rerio


Alignment Length:270 Identity:61/270 - (22%)
Similarity:96/270 - (35%) Gaps:82/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QVANVITHGIWIL------------PAVFAAIKLFERSSSASQYLVAWVYGGALCMLFTVSTFFH 138
            :..|:.||.:.::            |.::....|.|:......:|     |..||:.|  |..||
Zfish   134 ETGNIWTHLLGLILFLCLGTLTMLRPNMYFMAPLQEKVVFGMFFL-----GAVLCLSF--SWLFH 191

  Fly   139 CSCYCAEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGSYFPWLTLE---NTDHSAI 200
             :.||...|                  :.....:.|.:.|.:.|.||:.|||...   :.....|
Zfish   192 -TVYCHSEK------------------VSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLI 237

  Fly   201 LFCMEWVIWLMAGIGIAYQQVFHERYKCLETFFYLVMGLGPALVVVFTGHHFH-----------G 254
            ...:..|:.:.|.|...:.:....|::  .|...:.||||  |..:....||.           |
Zfish   238 YLTIVCVLGIAAIIVAQWDRFSTPRHR--PTRAGVFMGLG--LSGIVPTMHFTIEEGFVKATTVG 298

  Fly   255 MMQLKFGGGFYILGIVFFKADG----TIP------------MAHAIWHLFVVLAAGCHYYAILVN 303
            .|     |.||::|.::....|    .||            .:|.|:|:.||.||..|:|.: .|
Zfish   299 QM-----GWFYLMGAMYITGAGLYAARIPERYFPGKCDIWFHSHQIFHVLVVAAAFIHFYGV-SN 357

  Fly   304 L----YPSEG 309
            |    |..||
Zfish   358 LQEFRYGLEG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 56/259 (22%)
adipor1aNP_001314683.1 HlyIII 129..352 CDD:281059 54/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.