DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and CG7530

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_650387.1 Gene:CG7530 / 41784 FlyBaseID:FBgn0038256 Length:351 Species:Drosophila melanogaster


Alignment Length:267 Identity:56/267 - (20%)
Similarity:91/267 - (34%) Gaps:80/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 THGIWILPA---VFAAIKLFE------RSSSASQYLVAWVYGGALCMLFTVSTFFHC-SCYCAEH 146
            |..||...|   :|..:.:|:      .:|.:.|.||..:. ...|:...:|..:|. ||...||
  Fly   117 TINIWSHLAGCILFIGLTIFDLQFLRLHASLSDQVLVVCLL-VCFCLCMLMSAIYHIFSCKSEEH 180

  Fly   147 KPPKNVKAWPCLGWQTYQGLKNV-LHRCDRAMIYVFIAGSYFP-WL-TLENTDHSAILFCMEWVI 208
                            |:...:| ......:::.::|:|.|:. |. |...|.:|.|...     
  Fly   181 ----------------YELFLSVDFLGISLSLVAIYISGMYYAFWCHTFLRTLYSTIALG----- 224

  Fly   209 WLMAGIGIAYQQVFHERYKCLETFFYLVMGLGPALVVVFTGHHFHGMMQLKFGGG---------- 263
              |..:.||.|   ..|..........|:.|..|..::..||....|      ||          
  Fly   225 --MFALAIAVQ---IPRLNVSMNGKVAVLLLWSAYGIIPLGHWAVAM------GGLENELVRLMV 278

  Fly   264 -----FYILGIVFF--------------KADGTIPMAHAIWHLFVVLAAGCHYY---AILVNLYP 306
                 .|:|.:|.|              |.| .:..:|..||| :::||..|::   .:......
  Fly   279 PRIVLMYLLCLVAFVFYAAKIPERWFTGKVD-FVGHSHNWWHL-IIVAAFYHWHNTGLVYAEYRL 341

  Fly   307 SEGAAAP 313
            :.|..||
  Fly   342 NNGCTAP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 53/256 (21%)
CG7530NP_650387.1 HlyIII 111..329 CDD:281059 52/246 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468269
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20855
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.