DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and adipor1b

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_998665.1 Gene:adipor1b / 406821 ZFINID:ZDB-GENE-040426-2896 Length:377 Species:Danio rerio


Alignment Length:359 Identity:80/359 - (22%)
Similarity:129/359 - (35%) Gaps:99/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEGSGHESGIR--TLNRNANGNGNGDLSLMQDLQHKYAFLENLFSKFWKSI--------IKSNSN 58
            :|....|.|:|  ||...|    :..:..|::..||      ::...|:.|        :|.|..
Zfish    57 NEDEKEEGGLRVVTLPMQA----HHAMEKMEEFVHK------IWEGHWRVIPYHLLPDWLKDNDY 111

  Fly    59 LKLQLRNVKWKNAKAKPGCAYQ-PTEIEQVANVITH--GIWILPAVFAAIKLFERSSS----ASQ 116
            | |........:.:|..|..:: .||   ..|:.||  |: ||......:.:...:.|    ..:
Zfish   112 L-LHGHRPPMPSFRACFGSIFRIHTE---TGNIWTHLLGL-ILFLCLGTLTMLRPNVSFMAPVQE 171

  Fly   117 YLVAWVY--GGALCMLFTVSTFFHCSCYCAEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIY 179
            .:|..|:  |..||:.|  |..|| :.||...|                  :.....:.|.:.|.
Zfish   172 KVVFGVFFLGAVLCLCF--SWLFH-TVYCHSEK------------------VSRTFSKLDYSGIA 215

  Fly   180 VFIAGSYFPWLTLE---NTDHSAILFCMEWVIWLMAGIGIAYQQVFHERYKCLETFFYLVMGLGP 241
            :.|.||:.|||...   :.....|...:..|:.:.|.|...:.:....|::......:|.:||..
Zfish   216 LLIMGSFVPWLYYSFYCSPQPRLIYLSVVCVLGVAAIIVAQWDRFATPRHRSTRAGVFLGLGLSG 280

  Fly   242 ALVVVFTGHHFH-----------GMMQLKFGGGFYILGIVFFKA----DGTIP------------ 279
            .:..:    ||.           |.|     |.||::|.::...    ...||            
Zfish   281 LVPTM----HFTIAEGFVKATTVGQM-----GWFYLMGAMYISGAALYAARIPERYFPGRCDIWF 336

  Fly   280 MAHAIWHLFVVLAAGCHYYAILVNL----YPSEG 309
            .:|.|:|:.||.||..|:|.| .||    |..||
Zfish   337 QSHQIFHVLVVGAAFVHFYGI-SNLQEFRYGLEG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 55/256 (21%)
adipor1bNP_998665.1 HlyIII 131..354 CDD:281059 54/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.