DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and PAQR9

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001362229.1 Gene:PAQR9 / 344838 HGNCID:30131 Length:405 Species:Homo sapiens


Alignment Length:315 Identity:59/315 - (18%)
Similarity:93/315 - (29%) Gaps:130/315 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 QPTEIEQVANVITHGIWILPAVFAAIKLFERSSSASQY-----LVAWVYGGALCMLFTVSTFFHC 139
            :||  .:..|..||.|.:|..:....:||..|.....:     |..|.|...:.:.|.:|     
Human    79 KPT--NETLNFWTHFIPLLLFLSKFCRLFFLSGGDVPFHHPWLLPLWCYASGVLLTFAMS----- 136

  Fly   140 SCYCAEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGS-----YF--PWLTL----- 192
               |..|       .:.||..:    |:......|.|.|..:..||     |:  |.|:|     
Human   137 ---CTAH-------VFSCLSLR----LRAAFFYLDYASISYYGFGSTVAYYYYLLPGLSLLDARV 187

  Fly   193 -------------------------------------------ENTDHSAILFCMEWVIWLMAGI 214
                                                       ..||.....|.:...:::|. :
Human   188 MTPYLQQRLGWHVDCTRLIAAYRALVLPVAFVLAVACTVACCKSRTDWCTYPFALRTFVFVMP-L 251

  Fly   215 GIAYQQVFHERYKC---LETFFYLVMGLGPALVVVFTGHHFHGMMQLKFG----------GGFYI 266
            .:|          |   ||::.:.:.|..|.|.|.|...:|..::...|.          |.|.|
Human   252 SMA----------CPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDI 306

  Fly   267 LGIVFFKADGTIPMAHAIWHLFVVLAAGCHYYAILVNLYPSEG--------AAAP 313
            :|           .:|.::|:|..|:.....|      |..||        .|||
Human   307 IG-----------HSHQLFHIFTFLSIYDQVY------YVEEGLRQFLQAPPAAP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 51/291 (18%)
PAQR9NP_001362229.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
HlyIII 81..320 CDD:383485 50/281 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.