DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and Paqr9

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001258081.2 Gene:Paqr9 / 315904 RGDID:1311515 Length:373 Species:Rattus norvegicus


Alignment Length:315 Identity:59/315 - (18%)
Similarity:94/315 - (29%) Gaps:130/315 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 QPTEIEQVANVITHGIWILPAVFAAIKLFERSSSASQY-----LVAWVYGGALCMLFTVSTFFHC 139
            :||  .:..|..||.|.:|..:....:||....|...:     |..|.|...:.:.|.:|     
  Rat    75 KPT--NETLNFWTHFIPLLLFLSKFCRLFFLGGSDVPFHHPWLLPLWCYASGVLLTFAMS----- 132

  Fly   140 SCYCAEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGS-----YF--PWLTL----- 192
               |..|       .:.||..:    |:......|.|.|..:..||     |:  |.|:|     
  Rat   133 ---CTAH-------VFSCLSLR----LRAAFFYLDYASISYYGFGSTVAYYYYLLPSLSLLDARV 183

  Fly   193 -------------------------------------------ENTDHSAILFCMEWVIWLMAGI 214
                                                       ..||..:..|.:...:::|. :
  Rat   184 MTPYVQQRLGWHVDCTRLIAVYRALVLPVAFVLAVACTVACCKSRTDWCSYPFALRTFVFVMP-L 247

  Fly   215 GIAYQQVFHERYKC---LETFFYLVMGLGPALVVVFTGHHFHGMMQLKFG----------GGFYI 266
            .:|          |   ||::.:.:.|..|.|.|.|...:|..::...|.          |.|.|
  Rat   248 SMA----------CPIMLESWLFDLRGENPTLFVHFYRRYFWLVVAAFFNVSKIPERIQPGLFDI 302

  Fly   267 LGIVFFKADGTIPMAHAIWHLFVVLAAGCHYYAILVNLYPSEG--------AAAP 313
            :|           .:|.::|:|..|:.....|      |..||        .|||
  Rat   303 IG-----------HSHQLFHIFTFLSIYDQVY------YVEEGLRQFLQAPPAAP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 51/291 (18%)
Paqr9NP_001258081.2 HlyIII 77..316 CDD:413828 50/281 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.