DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and Paqr5

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001014114.1 Gene:Paqr5 / 315741 RGDID:1311259 Length:330 Species:Rattus norvegicus


Alignment Length:254 Identity:48/254 - (18%)
Similarity:83/254 - (32%) Gaps:105/254 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CAYQPTEIEQVANVITHGIWILPAVFAAIKLFERSSSASQYLVAWVYGGALCMLFTVSTFFHC-- 139
            ||:..:.:.:.|.   |..:.|.  :.|:.||...|:.:  ..|:.:..||    ..|||..|  
  Rat   100 CAHTFSSMSKNAR---HICYFLD--YGAVNLFSLGSAIA--YSAYTFPDAL----VCSTFHECYV 153

  Fly   140 -------------SCYC--AEHKPPKNVK-------AWPCLGWQTYQGLKNVLHRCDRAMIYVFI 182
                         |||.  .|.:.|:..|       |:| ..|.:               :.:|.
  Rat   154 ALAVLNTILSTGLSCYSRFLELQKPRLCKLLRVLAFAYP-YAWDS---------------LPIFY 202

  Fly   183 AGSYFPWLTLENTDHSAILFCMEWVIWLMAGIGIAYQQVFHERYKCLETFFY---LVMGLGPALV 244
            ....||.   |::.:.|:|:..:.::..:                 |.:|.|   |...|.|   
  Rat   203 RLFLFPG---ESSRNEAMLYHQKHMVMTL-----------------LASFLYSAHLPERLAP--- 244

  Fly   245 VVFTGHHFHGMMQLKFGGGFYILGIVFFKADGTIPMAHAIWHLFVVLAAGCHYYAILVN 303
                             |.|..:|           .:|.::|:.|:||......|||::
  Rat   245 -----------------GRFDYIG-----------HSHQLFHVCVILATHLQMEAILLD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 46/246 (19%)
Paqr5NP_001014114.1 HlyIII 43..269 CDD:281059 45/246 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.