DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and Mmd

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001007674.1 Gene:Mmd / 303439 RGDID:1592079 Length:238 Species:Rattus norvegicus


Alignment Length:253 Identity:107/253 - (42%)
Similarity:135/253 - (53%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LQLRN--VKWKNAKAKPGCAYQPTEIEQVANVITHGIWILPAVFAAIKLFERSSSASQYLVAWVY 123
            :|.||  .::.|.:|.....|:||..|..||..||...|:||:..:..|...|....:.:.||:|
  Rat     1 MQFRNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIY 65

  Fly   124 GGALCMLFTVSTFFHCSCYCAEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGSYFP 188
            |..||.||.|||.||...:...|                .:.:::..|.|||.:||.|||.||.|
  Rat    66 GMGLCALFIVSTVFHIVSWKKSH----------------LRTVEHCFHMCDRMVIYFFIAASYAP 114

  Fly   189 WLTLEN----TDHSAILFCMEWVIWLMAGIGIAYQQVFHERYKCLETFFYLVMGLGPALVVVFTG 249
            ||.|..    ..|      |.|.|||||..|..|..::||:||.:|.||||.||..|||||. :.
  Rat   115 WLNLRELGPLASH------MRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVT-SM 172

  Fly   250 HHFHGMMQLKFGGGFYILGIVFFKADGTIPMAHAIWHLFVVLAAGCHYYAILVNLYPS 307
            ::..|:.:|..||..|.||:||||:||.||.|||||||||..||..|||||...||.|
  Rat   173 NNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 96/222 (43%)
MmdNP_001007674.1 hlyIII 27..227 CDD:273425 96/222 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4729
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8204
Inparanoid 1 1.050 191 1.000 Inparanoid score I3784
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487730at2759
OrthoFinder 1 1.000 - - FOG0003169
OrthoInspector 1 1.000 - - otm46270
orthoMCL 1 0.900 - - OOG6_103941
Panther 1 1.100 - - O PTHR20855
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2564
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.