DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and Adipor1

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_997470.2 Gene:Adipor1 / 289036 RGDID:1303151 Length:375 Species:Rattus norvegicus


Alignment Length:268 Identity:56/268 - (20%)
Similarity:95/268 - (35%) Gaps:78/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QVANVITHGIWILPAVFAAIKLFERSSSASQYLVA----------WVYGGALCMLFTVSTFFHCS 140
            :..|:.||.:..:..:|..|....|   .:.|.:|          :..|..||:.|  |..|| :
  Rat   134 ETGNIWTHLLGFVLFLFLGILTMLR---PNMYFMAPLQEKVVFGMFFLGAVLCLSF--SWLFH-T 192

  Fly   141 CYCAEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGSYFPWLTLE---NTDHSAILF 202
            .||...|                  :.....:.|.:.|.:.|.||:.|||...   :.....|..
  Rat   193 VYCHSEK------------------VSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYL 239

  Fly   203 CMEWVIWLMAGIGIAYQQVFHERYKCLETFFYLVMGLGPALVVVFTGHHFH-----------GMM 256
            .:..|:.:.|.|...:.:....:::......:|.:||...:..:    ||.           |.|
  Rat   240 SIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTM----HFTIAEGFVKATTVGQM 300

  Fly   257 QLKFGGGFYILGIVFFKADG----TIP------------MAHAIWHLFVVLAAGCHYYAILVNL- 304
                 |.|:::.:::....|    .||            .:|.|:|:.||.||..|:|.: .|| 
  Rat   301 -----GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGV-SNLQ 359

  Fly   305 ---YPSEG 309
               |..||
  Rat   360 EFRYGLEG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 51/257 (20%)
Adipor1NP_997470.2 HlyIII 129..352 CDD:397239 49/250 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.