DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and MMD

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_006721858.1 Gene:MMD / 23531 HGNCID:7153 Length:269 Species:Homo sapiens


Alignment Length:278 Identity:109/278 - (39%)
Similarity:140/278 - (50%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LKLQLRNVKWKNAKAKPGCAYQPTEIEQVANVITHGIWILPAVFAAIKLFERSSSASQYLVAWVY 123
            ::.:.|..::.|.:|.....|:||..|..||..||...|:||:..:..|...|....:.:.||:|
Human     1 MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIY 65

  Fly   124 GGALCMLFTVSTFFHCSCYCAEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGSYFP 188
            |..||.||.|||.||...:...|                .:.:::..|.|||.:||.|||.||.|
Human    66 GMGLCALFIVSTVFHIVSWKKSH----------------LRTVEHCFHMCDRMVIYFFIAASYAP 114

  Fly   189 WL--------TLENT----DHSAIL--FC---------------MEWVIWLMAGIGIAYQQVFHE 224
            |.        .|.||    ...|:|  ||               |.|.|||||..|..|..::||
Human   115 WFFSLRFVSNLLPNTWSEIKGQAVLTSFCLIGLNLRELGPLASHMRWFIWLMAAGGTIYVFLYHE 179

  Fly   225 RYKCLETFFYLVMGLGPALVVVFTGHHFHGMMQLKFGGGFYILGIVFFKADGTIPMAHAIWHLFV 289
            :||.:|.||||.||..|||||. :.::..|:.:|..||..|.||:||||:||.||.|||||||||
Human   180 KYKVVELFFYLTMGFSPALVVT-SMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHLFV 243

  Fly   290 VLAAGCHYYAILVNLYPS 307
            ..||..|||||...||.|
Human   244 ATAAAVHYYAIWKYLYRS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 100/247 (40%)
MMDXP_006721858.1 hlyIII 27..258 CDD:273425 100/247 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4859
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8204
Inparanoid 1 1.050 191 1.000 Inparanoid score I3877
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487730at2759
OrthoFinder 1 1.000 - - FOG0003169
OrthoInspector 1 1.000 - - otm42122
orthoMCL 1 0.900 - - OOG6_103941
Panther 1 1.100 - - O PTHR20855
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3376
SonicParanoid 1 1.000 - - X2564
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.