DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and PAQR3

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001035292.1 Gene:PAQR3 / 152559 HGNCID:30130 Length:311 Species:Homo sapiens


Alignment Length:284 Identity:61/284 - (21%)
Similarity:99/284 - (34%) Gaps:93/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 AYQPTEI---------EQVANVITH----------GIWILPAVFAAIKLFERSSSASQYLVAWV- 122
            ||.|:.:         .:..|:.:|          ||:.:.:|     |...|:|...:::..: 
Human    52 AYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSV-----LPSASASREDFVICSIC 111

  Fly   123 -YGGALCMLFTVSTFFHC-SCYCAEHKPPKNVKAWPCLGWQTYQGLK-NVLHRCDRAMIYVFIAG 184
             :...:|||.:|.  :|. ||    |:..|..:.|..|   .|.|:. .:|......:.|.|...
Human   112 LFCFQVCMLCSVG--YHLFSC----HRSEKTCRRWMAL---DYAGISIGILGCYVSGVFYAFYCN 167

  Fly   185 SYF----------------------PWLTLENTDHSAILFC----------MEWVIWLMAGIGIA 217
            :|:                      .:||.:.....:|:||          :.|| ||..|||..
Human   168 NYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWV-WLNGGIGAP 231

  Fly   218 YQQVFHERYKCLETFFYLVMGLGPALVVVFTGHHFHGMMQLKFGGGFYILGIVFFKADGTIPMAH 282
            ..|.|..|        .:||.:...|..:|   :...:.:..|.|....||           .:|
Human   232 IVQDFAPR--------VIVMYMIALLAFLF---YISKVPERYFPGQLNYLG-----------SSH 274

  Fly   283 AIWH-LFVVLAAGCHYYAILVNLY 305
            .||| |.||:....|...:.|..|
Human   275 QIWHILAVVMLYWWHQSTVYVMQY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 57/265 (22%)
PAQR3NP_001035292.1 Golgi targeting 61..71 0/9 (0%)
HlyIII 64..283 CDD:308575 53/255 (21%)
Golgi targeting 299..303 61/284 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.