DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4615 and LOC103909971

DIOPT Version :9

Sequence 1:NP_572382.1 Gene:CG4615 / 31656 FlyBaseID:FBgn0029935 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_009296615.1 Gene:LOC103909971 / 103909971 -ID:- Length:235 Species:Danio rerio


Alignment Length:243 Identity:101/243 - (41%)
Similarity:138/243 - (56%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LRNVKWKNAKAKPGCAYQPTEIEQVANVITHGIWILPAVFAAIKLFERSSSASQYLVAWVYGGAL 127
            ::.|::.|.:|.....|||||.|..||..||.:||:|::...|.|:..|....:.:.||:||..|
Zfish     1 MKLVRFMNNRAPYNKRYQPTEYEHAANCATHALWIIPSIVGGILLYFLSDDHWEEISAWLYGAGL 65

  Fly   128 CMLFTVSTFFHCSCYCAEHKPPKNVKAWPCLGWQTYQGLKNVLHRCDRAMIYVFIAGSYFPWLTL 192
            ..||.:||.||...:...|                .:.:::..|.|||.:||.|||.||.|||||
Zfish    66 SSLFIISTVFHTVSWKKSH----------------LRSVEHCFHMCDRMVIYFFIAASYTPWLTL 114

  Fly   193 ENTDHSAILFCMEWVIWLMAGIGIAYQQVFHERYKCLETFFYLVMGLGPALVVVFTGHHFHGMMQ 257
            .:....|.  .|.||:|:||..|.||...|||::|.:|...|:.||:.||||::..... .|:.:
Zfish   115 RDLGPWAA--HMRWVVWVMASGGTAYVFFFHEKFKVVELICYIAMGVFPALVILSMADR-SGLCE 176

  Fly   258 LKFGGGFYILGIVFFKADGTIPMAHAIWHLFVVLAAGCHYYAILVNLY 305
            |..|||.|:||:.|||:||.:|.|||||||||.:.||.|||||...||
Zfish   177 LLLGGGCYVLGMAFFKSDGIVPFAHAIWHLFVAMGAGIHYYAIWKYLY 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4615NP_572382.1 hlyIII 85..304 CDD:273425 91/218 (42%)
LOC103909971XP_009296615.1 HlyIII 23..223 CDD:296067 91/218 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4790
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 197 1.000 Inparanoid score I3782
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487730at2759
OrthoFinder 1 1.000 - - FOG0003169
OrthoInspector 1 1.000 - - otm24365
orthoMCL 1 0.900 - - OOG6_103941
Panther 1 1.100 - - O PTHR20855
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2564
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.