DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4607 and VBA4

DIOPT Version :9

Sequence 1:NP_572380.1 Gene:CG4607 / 31653 FlyBaseID:FBgn0029932 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_010404.1 Gene:VBA4 / 851697 SGDID:S000002526 Length:768 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:32/143 - (22%)
Similarity:55/143 - (38%) Gaps:30/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 TTFFGFQQACGVVVIIVYAVQIAQQAGVTIDPVLVAVMLGVARIITTLFMSGIFEKWGRKPSGIF 370
            ||:|       ::|:.:..:|:|::    :.|...:::||       .|....|  |..|.....
Yeast   545 TTYF-------IIVLNLSTLQLAER----LSPFFFSIVLG-------YFSVSYF--WKSKGQNFL 589

  Fly   371 SATGMGACMLLLAGGNWFPDTLGTLHWLPV----ACIVAHIVFSTMGMLTLPFFMISEVFPQRAR 431
            ....:....|||     :...:|....|||    .|:....:.|:| :|||...:..|...||..
Yeast   590 LKFVLSGATLLL-----YVALMGVSLNLPVWKQYICLSLPFLGSSM-ILTLLSNLYHEYHEQRKS 648

  Fly   432 GSASGIAIFFGMI 444
            ..:..|...||.:
Yeast   649 PISGSIVYCFGAV 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4607NP_572380.1 MFS 55..484 CDD:119392 32/143 (22%)
SP 67..495 CDD:273317 32/143 (22%)
VBA4NP_010404.1 MFS 259..>414 CDD:421695
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.