DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4607 and PMT5

DIOPT Version :10

Sequence 1:NP_572380.1 Gene:CG4607 / 31653 FlyBaseID:FBgn0029932 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_188513.1 Gene:PMT5 / 821416 AraportID:AT3G18830 Length:539 Species:Arabidopsis thaliana


Alignment Length:118 Identity:24/118 - (20%)
Similarity:42/118 - (35%) Gaps:32/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 KHGLIDNFELKDNWLTHAVASACAGLAAAIVSLPSDVVK---------TRMMDQIRHELDAKMMH 262
            || |.:..|:|...|..|::...|.:  |::.|.|...|         .|..|::..:|..:..:
plant   921 KH-LEEVLEMKQEALLAAISEKDANI--ALLELSSSKKKKTQDEVASLKREKDRLVQQLKQQTQN 982

  Fly   263 KKNTHVDLYKG--------------------VVDCYIKIIKNEGFFSLYKGFL 295
            :.....|.|:|                    ::...|.:.:|.....||.|.|
plant   983 RMKLMADNYEGDHMKCSAHSNQTNHKPSPDQMIQPLIDLDQNRSKLKLYIGHL 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4607NP_572380.1 MFS_GLUT6_8_Class3_like 47..494 CDD:340916 24/118 (20%)
PMT5NP_188513.1 MFS_PLT 42..494 CDD:340995
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.