DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4607 and SLC2A4

DIOPT Version :9

Sequence 1:NP_572380.1 Gene:CG4607 / 31653 FlyBaseID:FBgn0029932 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001033.1 Gene:SLC2A4 / 6517 HGNCID:11009 Length:509 Species:Homo sapiens


Alignment Length:486 Identity:124/486 - (25%)
Similarity:206/486 - (42%) Gaps:69/486 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LMVFLGNSGVLGSGM------VVSMPAVTLNQLHDETQPFWLNKD-------------ESSWFAS 92
            |.||   |.||||..      |::.|...:.|.::||   ||.:.             .:.|..|
Human    26 LAVF---SAVLGSLQFGYNIGVINAPQKVIEQSYNET---WLGRQGPEGPSSIPPGTLTTLWALS 84

  Fly    93 IQNMACPLGGLLVSYFLDRI----GRKHTILLTNLIGLIGWILLVTSFMHSDRDMIYYQMLLGRC 153
            :...:  :||::.|:.:..|    |||..:|:.|::.::|..|:..    ::....|..::|||.
Human    85 VAIFS--VGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGL----ANAAASYEMLILGRF 143

  Fly   154 FGGIMIGMFVSPVGVYSAEISLPKIRGRLILGTSLGLASGILLMYCLGYFIRHNIQLIFGISCCY 218
            ..|...|:....|.:|..||:...:||.|.....|.:..|||:...||      ::.:.|.:..:
Human   144 LIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLG------LESLLGTASLW 202

  Fly   219 QLAATLLVFP----------MPESPSWL-LTRGKEERARKSLRYFRGLPKKEVDYVPEFEAELAH 272
            .|...|.|.|          .||||.:| :.:..|..|||||:...|...     |....|||..
Human   203 PLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPARKSLKRLTGWAD-----VSGVLAELKD 262

  Fly   273 MKELADASNTTAAGESLSQMIHR-PEVYKPVLMMTTFFGFQQACGVVVIIVYAVQIAQQAGVTID 336
            .|...:.....:..:.|....|| |.:...||.::     ||..|:..:..|:..|.:.|||. .
Human   263 EKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLS-----QQLSGINAVFYYSTSIFETAGVG-Q 321

  Fly   337 PVLVAVMLGVARIITTLFMSGIFEKWGRKPSGIFSATGMGACMLLLAGGNWFPDTLGTLHWLPVA 401
            |....:..||...:.||....:.|:.||:...:....||..|.:|:.......:.:..:.::.:.
Human   322 PAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSYVSIV 386

  Fly   402 CIVAHIVFSTMGMLTLPFFMISEVFPQRARGSASGIAIFFGMILAFIMLKIYPNMEAALGTANLF 466
            .|...:.|..:|...:|:|:::|:|.|..|.:|..:|.|......||:...:..:..|:|.   :
Human   387 AIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGP---Y 448

  Fly   467 AFYAGISFLAAAFIGVF--VPETRGRTLEEL 495
            .|......|...||..|  ||||||||.:::
Human   449 VFLLFAVLLLGFFIFTFLRVPETRGRTFDQI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4607NP_572380.1 MFS 55..484 CDD:119392 112/465 (24%)
SP 67..495 CDD:273317 114/458 (25%)
SLC2A4NP_001033.1 Interaction with SRFBP1. /evidence=ECO:0000269|PubMed:16647043 7..13
Sugar_tr 27..483 CDD:306568 123/485 (25%)
Monosaccharide binding. /evidence=ECO:0000250|UniProtKB:P11166 298..304 3/5 (60%)
Dileucine internalization motif. /evidence=ECO:0000269|PubMed:8300557 489..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.