DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4607 and srx-118

DIOPT Version :9

Sequence 1:NP_572380.1 Gene:CG4607 / 31653 FlyBaseID:FBgn0029932 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_496675.2 Gene:srx-118 / 188681 WormBaseID:WBGene00006009 Length:328 Species:Caenorhabditis elegans


Alignment Length:289 Identity:64/289 - (22%)
Similarity:101/289 - (34%) Gaps:93/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 ELADASNTTAAGESLSQMIHRPEVYKPVLMMTTFF------GFQQAC------GVVVIIVYAV-- 325
            |.:..|..|.:...|..:.....:...::.:.|||      ||.:.|      ..:|.|.|..  
 Worm    12 EFSTPSTRTVSAVMLIVVSIIGSIMNVLIFIATFFRVTKRDGFLKICCFNSFGSCIVCIGYLAFP 76

  Fly   326 -------------------QIAQQAGVTIDPVLVAVMLGVARIITTLFMSGIFEKWGRKPSGIFS 371
                               |.....|.:|.| |..::|.|.|||...|.....:|:...|:.:  
 Worm    77 VPSLLLEDPPNHWLNAAMGQFIAWFGWSIGP-LSQILLTVNRIIAVYFPLLYMKKYRYNPTNV-- 138

  Fly   372 ATGMG-----ACMLLLAGGNWFP---------DTLGTLHWLP--VACI-----VAHIVFSTMGML 415
              |:|     |.:||:   ::||         |.||   |:.  ..||     ...:|..|:..|
 Worm   139 --GIGFSFFVAFILLV---SFFPEGCHYLFNRDYLG---WVGEFTPCIDIMQKTFLVVMMTICAL 195

  Fly   416 TL--------------PFFMISEVFPQRARGSASGIAIFFGMILAFIMLKIYPNMEAALGTANLF 466
            |.              |.|.:|..  |.|........:....|:..|:: |..::.:.: |.|||
 Worm   196 TTCCSVLLFIKLIIHSPNFRVSNA--QLANRHRKNRKLIIQAIVQSILI-IVDSLNSTI-TYNLF 256

  Fly   467 --AFYAGISFLAAAFIGVFVPETRGRTLE 493
              .|:   .|:..:|..||:     ||||
 Worm   257 PNLFF---QFITLSFSMVFL-----RTLE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4607NP_572380.1 MFS 55..484 CDD:119392 59/278 (21%)
SP 67..495 CDD:273317 64/289 (22%)
srx-118NP_496675.2 7TM_GPCR_Srx 27..285 CDD:370981 60/274 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.