DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4607 and K09C4.2

DIOPT Version :9

Sequence 1:NP_572380.1 Gene:CG4607 / 31653 FlyBaseID:FBgn0029932 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:108 Identity:24/108 - (22%)
Similarity:50/108 - (46%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 VAHIVFSTMGMLTLPFFMISEVFPQRARGSASGIAIFFG-MILAFIMLKIYPNMEAALGTANLFA 467
            :...|....|...:....::|:||..|| :..|.|:.|| |.:...::.::|.:.:..... .|.
 Worm     4 ITSTVVPATGANAIRLLFVTELFPPSAR-TVVGQAMLFGSMAVGMPVVSLFPIINSIFSPI-FFV 66

  Fly   468 FYAGISFLAAAFIGVFVPETRGRTLEELEERWQTGKFSRRLTI 510
            .:..:..:...::..::||||||.:.::.|.......||.::|
 Worm    67 PFVIVQTVFGIYLYRYMPETRGRAVYDIIESMDKDVASRAVSI 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4607NP_572380.1 MFS 55..484 CDD:119392 14/80 (18%)
SP 67..495 CDD:273317 20/91 (22%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 17/79 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.