DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4593 and AT5G11500

DIOPT Version :9

Sequence 1:NP_001284975.1 Gene:CG4593 / 31649 FlyBaseID:FBgn0029929 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_196711.1 Gene:AT5G11500 / 831022 AraportID:AT5G11500 Length:215 Species:Arabidopsis thaliana


Alignment Length:216 Identity:121/216 - (56%)
Similarity:156/216 - (72%) Gaps:8/216 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFYFKSNVVQPPAMLYMGRDKHENEELIRWGWPEDVWFHVHDLSSAHVYLRLRKGQTIDDIPTD 65
            ||||||:........::||.||.||||||::|:||||||||..:|||||||||.:||:.|||...
plant     1 MVFYFKARPDAGDYTIFMGLDKFENEELIKYGFPEDVWFHVDKMSSAHVYLRLHRGQSFDDISEG 65

  Fly    66 VLVDAAQLCKANSIQGNKVNNLEVVYTMWENLKKTPDMEPGQVAYHNEKAVRRIRLEKRINEIVN 130
            ||.|.|||.||||||||||||::||||.|.|||||..|:.|||.:||.|.||.||:|||:|||||
plant    66 VLEDCAQLVKANSIQGNKVNNVDVVYTPWSNLKKTASMDVGQVGFHNSKMVRTIRVEKRVNEIVN 130

  Fly   131 RLNRTKTEEEHPDFRGLREARDAAERQDQKKIQRERREQEKEAAKQRELEAELRSYASLQKSENM 195
            |||:||.|.. ||.|..|||.:||||.::|:..||::::|:....::|.::|:|||..|..::.|
plant   131 RLNKTKVERT-PDLRAEREAVNAAERAERKQHLREKKKREEIDRLEKERQSEMRSYKGLMVTDKM 194

  Fly   196 RTNYD--AGNES-----DDFM 209
            .:|.|  :.|:|     ||||
plant   195 TSNKDIASSNKSLQELEDDFM 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4593NP_001284975.1 DUF814 7..99 CDD:283353 58/91 (64%)
DUF4337 <123..>182 CDD:290935 28/58 (48%)
AT5G11500NP_196711.1 DUF814 1..112 CDD:398994 71/110 (65%)
PTZ00266 <114..>182 CDD:173502 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 153 1.000 Domainoid score I1375
eggNOG 1 0.900 - - E1_KOG3272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6645
Inparanoid 1 1.050 232 1.000 Inparanoid score I1135
OMA 1 1.010 - - QHG53870
OrthoDB 1 1.010 - - D1380409at2759
OrthoFinder 1 1.000 - - FOG0004988
OrthoInspector 1 1.000 - - oto3914
orthoMCL 1 0.900 - - OOG6_102835
Panther 1 1.100 - - LDO PTHR13049
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3521
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.