DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4593 and Ccdc25

DIOPT Version :9

Sequence 1:NP_001284975.1 Gene:CG4593 / 31649 FlyBaseID:FBgn0029929 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_666056.1 Gene:Ccdc25 / 67179 MGIID:1914429 Length:208 Species:Mus musculus


Alignment Length:211 Identity:119/211 - (56%)
Similarity:162/211 - (76%) Gaps:5/211 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFYFKSNVVQPPA-MLYMGRDKHENEELIRWGWPEDVWFHVHDLSSAHVYLRLRKGQTIDDIPT 64
            |||||.|:.|.... .:|||:||:|||:||::|||||:||||..||||||||||:||:.|:|||.
Mouse     1 MVFYFTSSSVNSSTYTIYMGKDKYENEDLIKYGWPEDIWFHVDKLSSAHVYLRLQKGEKIEDIPK 65

  Fly    65 DVLVDAAQLCKANSIQGNKVNNLEVVYTMWENLKKTPDMEPGQVAYHNEKAVRRIRLEKRINEIV 129
            :||:|.|.|.|||||||.|:||:.||||.|.|||||.||:.||:.:|.:|.|:.:.:||::|||:
Mouse    66 EVLMDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIVTVEKKVNEIL 130

  Fly   130 NRLNRTKTEEEHPDFRGLREARDAAERQDQK-KIQRERREQEKEAAKQRELEAELRSYASLQKSE 193
            |||.:||. |:.||....:|.||..||.::| :||..:|::::|..|:||:: |||||:||.|.|
Mouse   131 NRLEKTKL-EKFPDLAAEKEGRDREERNEKKAQIQEMKRKEKEEMKKKREMD-ELRSYSSLMKVE 193

  Fly   194 NMRTNYDAGNESDDFM 209
            ||.:|.| ||:||:||
Mouse   194 NMSSNQD-GNDSDEFM 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4593NP_001284975.1 DUF814 7..99 CDD:283353 59/92 (64%)
DUF4337 <123..>182 CDD:290935 25/59 (42%)
Ccdc25NP_666056.1 DUF814 1..112 CDD:368552 71/110 (65%)
DNA-binding. /evidence=ECO:0000250|UniProtKB:Q86WR0 21..25 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..208 30/65 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849735
Domainoid 1 1.000 157 1.000 Domainoid score I4167
eggNOG 1 0.900 - - E1_KOG3272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6645
Inparanoid 1 1.050 238 1.000 Inparanoid score I3369
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53870
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004988
OrthoInspector 1 1.000 - - oto92690
orthoMCL 1 0.900 - - OOG6_102835
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2167
SonicParanoid 1 1.000 - - X3521
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.690

Return to query results.
Submit another query.