DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4593 and ccdc25

DIOPT Version :9

Sequence 1:NP_001284975.1 Gene:CG4593 / 31649 FlyBaseID:FBgn0029929 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001004803.1 Gene:ccdc25 / 448037 XenbaseID:XB-GENE-5887637 Length:206 Species:Xenopus tropicalis


Alignment Length:210 Identity:125/210 - (59%)
Similarity:167/210 - (79%) Gaps:5/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFYFKSNVVQPPAMLYMGRDKHENEELIRWGWPEDVWFHVHDLSSAHVYLRLRKGQTIDDIPTD 65
            |||||.|||:.||..:|||:||:|||:||::|||||:||||..||||||||||:|.|||:|||.:
 Frog     1 MVFYFTSNVISPPYTMYMGKDKYENEDLIKYGWPEDIWFHVDKLSSAHVYLRLQKDQTIEDIPKE 65

  Fly    66 VLVDAAQLCKANSIQGNKVNNLEVVYTMWENLKKTPDMEPGQVAYHNEKAVRRIRLEKRINEIVN 130
            ||:|.|||.|||||||.|:||:.||||.|.|||||.||:.||:.:|.:|.|:.:.:|| :::|||
 Frog    66 VLLDCAQLVKANSIQGCKMNNINVVYTPWANLKKTADMDIGQIGFHRQKDVKTMTVEK-VSKIVN 129

  Fly   131 RLNRTKTEEEHPDFRGLREARDAAERQDQK-KIQRERREQEKEAAKQRELEAELRSYASLQKSEN 194
            ||.:|| :|..||....:||||..||.::| :||..:|::::|..|::|:: |||||:||.||||
 Frog   130 RLEKTK-DERFPDLAAEKEARDREERNEKKAQIQEIKRKEKEEMKKKKEMD-ELRSYSSLMKSEN 192

  Fly   195 MRTNYDAGNESDDFM 209
            |.:|.| ||:|||||
 Frog   193 MSSNQD-GNDSDDFM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4593NP_001284975.1 DUF814 7..99 CDD:283353 64/91 (70%)
DUF4337 <123..>182 CDD:290935 24/59 (41%)
ccdc25NP_001004803.1 DUF814 1..111 CDD:398994 76/109 (70%)
DNA-binding. /evidence=ECO:0000250|UniProtKB:Q86WR0 20..24 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..206 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3667
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6645
Inparanoid 1 1.050 251 1.000 Inparanoid score I3138
OMA 1 1.010 - - QHG53870
OrthoDB 1 1.010 - - D1380409at2759
OrthoFinder 1 1.000 - - FOG0004988
OrthoInspector 1 1.000 - - oto102978
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2167
SonicParanoid 1 1.000 - - X3521
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.