DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4593 and ccdc25

DIOPT Version :9

Sequence 1:NP_001284975.1 Gene:CG4593 / 31649 FlyBaseID:FBgn0029929 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_956682.1 Gene:ccdc25 / 393359 ZFINID:ZDB-GENE-040426-1389 Length:207 Species:Danio rerio


Alignment Length:210 Identity:121/210 - (57%)
Similarity:164/210 - (78%) Gaps:4/210 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFYFKSNVVQPPAMLYMGRDKHENEELIRWGWPEDVWFHVHDLSSAHVYLRLRKGQTIDDIPTD 65
            |||||.|.||.||..:|||:||:|||:||::|||||:||||..|||||||||:.||.||||||.:
Zfish     1 MVFYFTSAVVSPPHTIYMGKDKYENEDLIKYGWPEDIWFHVDKLSSAHVYLRMPKGTTIDDIPKE 65

  Fly    66 VLVDAAQLCKANSIQGNKVNNLEVVYTMWENLKKTPDMEPGQVAYHNEKAVRRIRLEKRINEIVN 130
            ||:|..||.|.|||||.|:||:.:|||.|.|||||.||:.||:.:|.:|.|:.:.:||:||||||
Zfish    66 VLIDCVQLVKNNSIQGCKMNNINIVYTPWSNLKKTADMDIGQIGFHRQKEVKIVAVEKKINEIVN 130

  Fly   131 RLNRTKTEEEHPDFRGLREARDAAERQDQK-KIQRERREQEKEAAKQRELEAELRSYASLQKSEN 194
            ||.:|| ||.:||....:|:||..||.::| :||.:::::::|..|::|:| :|::|.||.||:|
Zfish   131 RLEKTK-EERYPDLAAEKESRDREERNEKKAQIQEQKKKEKEEVKKKKEME-DLKNYTSLMKSDN 193

  Fly   195 MRTNYDAGNESDDFM 209
            |.||.| |.:|||||
Zfish   194 MTTNED-GYDSDDFM 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4593NP_001284975.1 DUF814 7..99 CDD:283353 61/91 (67%)
DUF4337 <123..>182 CDD:290935 27/59 (46%)
ccdc25NP_956682.1 DUF814 4..99 CDD:283353 63/94 (67%)
DNA-binding. /evidence=ECO:0000250|UniProtKB:Q86WR0 20..24 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..207 29/68 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595517
Domainoid 1 1.000 167 1.000 Domainoid score I3818
eggNOG 1 0.900 - - E1_KOG3272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6645
Inparanoid 1 1.050 252 1.000 Inparanoid score I3202
OMA 1 1.010 - - QHG53870
OrthoDB 1 1.010 - - D1380409at2759
OrthoFinder 1 1.000 - - FOG0004988
OrthoInspector 1 1.000 - - oto39596
orthoMCL 1 0.900 - - OOG6_102835
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2167
SonicParanoid 1 1.000 - - X3521
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.