DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4593 and F43C1.7

DIOPT Version :9

Sequence 1:NP_001284975.1 Gene:CG4593 / 31649 FlyBaseID:FBgn0029929 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001022586.2 Gene:F43C1.7 / 3564937 WormBaseID:WBGene00023423 Length:140 Species:Caenorhabditis elegans


Alignment Length:137 Identity:63/137 - (45%)
Similarity:93/137 - (67%) Gaps:1/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFYFKSNVVQPPAMLYMGRDKHENEELIRWGWPEDVWFHVHDLSSAHVYLRLRKGQTIDDIPTD 65
            |||.|.|:.|.|||:::||..:.|||:|.:.|.|.||||||..:|||||||:|..|.|||.||.:
 Worm     1 MVFGFISSTVTPPALIFMGEHQVENEKLFKCGDPGDVWFHVDKVSSAHVYLQLPSGITIDTIPEE 65

  Fly    66 VLVDAAQLCKANSIQGNKVNNLEVVYTMWENLKKTPDMEPGQVAYHNEKAVR-RIRLEKRINEIV 129
            :|.:..||.|.|||||.|:..:||.||:.|||||...|:.|::.::::..:: |..|:|...:::
 Worm    66 LLEECCQLVKKNSIQGVKMEKVEVNYTLKENLKKVKGMQTGEIGFYDKNIIKSRSVLKKNTKKVL 130

  Fly   130 NRLNRTK 136
            .:|..|:
 Worm   131 QQLEGTQ 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4593NP_001284975.1 DUF814 7..99 CDD:283353 50/91 (55%)
DUF4337 <123..>182 CDD:290935 3/14 (21%)
F43C1.7NP_001022586.2 DUF814 1..112 CDD:368552 58/110 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166968
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570717at33208
OrthoFinder 1 1.000 - - FOG0004988
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13049
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2167
SonicParanoid 1 1.000 - - X3521
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.840

Return to query results.
Submit another query.