DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4593 and PKD1L3

DIOPT Version :9

Sequence 1:NP_001284975.1 Gene:CG4593 / 31649 FlyBaseID:FBgn0029929 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_853514.1 Gene:PKD1L3 / 342372 HGNCID:21716 Length:1732 Species:Homo sapiens


Alignment Length:82 Identity:22/82 - (26%)
Similarity:33/82 - (40%) Gaps:18/82 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SSAHVYLRLRKGQTIDDIPTDVLVDAAQLCKANSIQG-NKVNNLEVVYTMWENLKK-TPDM-EPG 106
            |...|.|:...||.||:|       |....:|  :.| ..:|.|:......:.|.. ||.. :|.
Human   266 SYLQVSLQKASGQVIDEI-------AGNFSRA--VHGLQALNKLQEACEFLQKLTALTPRFSKPA 321

  Fly   107 QV------AYHNEKAVR 117
            ||      .|.:|:.:|
Human   322 QVNLINSLIYLSEELLR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4593NP_001284975.1 DUF814 7..99 CDD:283353 14/54 (26%)
DUF4337 <123..>182 CDD:290935
PKD1L3NP_853514.1 CLECT 33..138 CDD:153057
GPS 633..672 CDD:295363
PLAT_polycystin 743..859 CDD:238850
PKD_channel <1446..1678 CDD:285288
Channel pore-region 1613..1651
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.