DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4593 and Y54G11A.2

DIOPT Version :9

Sequence 1:NP_001284975.1 Gene:CG4593 / 31649 FlyBaseID:FBgn0029929 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_496971.1 Gene:Y54G11A.2 / 175082 WormBaseID:WBGene00013213 Length:210 Species:Caenorhabditis elegans


Alignment Length:211 Identity:108/211 - (51%)
Similarity:143/211 - (67%) Gaps:3/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFYFKSNVVQPPAMLYMGRDKHENEELIRWGWPEDVWFHVHDLSSAHVYLRLRKGQTIDDIPTD 65
            ||..|.||...||.|:|||.||.|||:||::||||||||||..||||||||||..|.|||.||..
 Worm     1 MVIKFSSNTTNPPTMIYMGVDKVENEDLIKYGWPEDVWFHVDKLSSAHVYLRLHSGMTIDSIPEA 65

  Fly    66 VLVDAAQLCKANSIQGNKVNNLEVVYTMWENLKKTPDMEPGQVAYHNEKAVRRIRLEKRINEIVN 130
            :|:|..||.|.|||:|.|:||:.:|||||.|||||.||..|||.:|:.|.|:...:..:||||||
 Worm    66 LLIDCCQLVKQNSIEGCKLNNVAIVYTMWSNLKKTGDMAVGQVGFHSHKQVKHTVVPTKINEIVN 130

  Fly   131 RLNRTKTEEEHPDFRGLREARDAAERQDQKKIQRERREQEKEAAKQRELEAELRSYASL--QKSE 193
            ||.:|:.::: .|::..|:||||.|||..||:::||:::||:....:..:..:..|..:  ....
 Worm   131 RLEKTRRKDD-IDYKEERDARDAKERQKLKKLEQERKDREKKEMLAQNEKKRIEGYEDVDWDAGA 194

  Fly   194 NMRTNYDAGNESDDFM 209
            ..|.:.|.||.|||||
 Worm   195 TTRNDVDPGNLSDDFM 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4593NP_001284975.1 DUF814 7..99 CDD:283353 60/91 (66%)
DUF4337 <123..>182 CDD:290935 24/58 (41%)
Y54G11A.2NP_496971.1 DUF814 15..111 CDD:368552 64/95 (67%)
Selenoprotein_S <88..>173 CDD:369143 42/85 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166967
Domainoid 1 1.000 157 1.000 Domainoid score I2548
eggNOG 1 0.900 - - E1_KOG3272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6645
Inparanoid 1 1.050 218 1.000 Inparanoid score I2309
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53870
OrthoDB 1 1.010 - - D1380409at2759
OrthoFinder 1 1.000 - - FOG0004988
OrthoInspector 1 1.000 - - oto20099
orthoMCL 1 0.900 - - OOG6_102835
Panther 1 1.100 - - LDO PTHR13049
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2167
SonicParanoid 1 1.000 - - X3521
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.