DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG6791

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:662 Identity:128/662 - (19%)
Similarity:193/662 - (29%) Gaps:284/662 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCCTCLLQ-LEKEPLKTELQSDEIPISQELQQLLNINLSQDVENQDADQQWLPNELCLECRSAVQ 76
            ||..|..: :||:..:|     .:.::..:..|..:|.....|.|         ..|.||...:.
  Fly   515 LCPQCGKEFIEKKHWRT-----HVVMAHSMNDLSKLNFEMINERQ---------LKCTECDKIIT 565

  Fly    77 N----------------FEKFRR-----KADECRKQLLEML-----------------------K 97
            |                |:.:.|     |:...||.|::.|                       .
  Fly   566 NAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHRVGWPRKLSGGCPAPILTPA 630

  Fly    98 KDPRE-------PTFEVVY------DGREED---------QESLHGLEPPEPAPDPDPIDEPAIK 140
            |.||:       .|:|::|      .|.|||         :|..:.:.||.|:|.|         
  Fly   631 KQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDFGEQMQAEEDEYPIAPPPPSPPP--------- 686

  Fly   141 SDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHI------RKVHEGSKRP-------------- 185
               .|:.:.:|:....||..|...||.|..:..||      :.|....::|              
  Fly   687 ---PPQPTTQGNHQRYKCVHCGTLFATQAAVRVHISEKRCRKTVVRRRRQPVMSSADPSVPTVEQ 748

  Fly   186 ---FQCDQCEKAYSFMGGLYTHIREVHAPKER-----------RHPCDQPGCERIY-TSRI-AMQ 234
               |.|..|...|........||.|||...:|           |:.|.|  |:.|. .|:: .:|
  Fly   749 NYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQYLNMRQLDKYRYQCTQ--CKDIVCNSKLKGLQ 811

  Fly   235 KHKRLKHSPRDRDALKKFICEQCGASFNQSANLKYHLKTKH-------PT--------------- 277
            .| ..:|.|. |..||   |..||..:|...|:..||:.:|       ||               
  Fly   812 DH-HFRHLPY-RLYLK---CLICGTCYNHKPNIAAHLRARHSIFDRETPTMITKPKQVLGRYKDN 871

  Fly   278 --------------------------EDEVAA---------REGGAGER---------------- 291
                                      ....||         :.||...|                
  Fly   872 SRENPKLPSPPPAPALAPAPPSPPACSSSAAASASSRSLKPQPGGLPARPAGLNTLEDSISYHNA 936

  Fly   292 -------HFCDICQKEFHSRYTLKYHTLQQHEVQ------------------------------- 318
                   :||..|.:.|.|....:.|.::||...                               
  Fly   937 VDLDFITYFCPKCNQNFDSHAFWRKHIVEQHNFNSREGLNFRQIDNHHYLCLECYKRVTVTHTKG 1001

  Fly   319 ----------EELPH---ECQVCGRRMAKKFMLLQHMLMHSNDKLPCEHCGRRFARRFELEAHVR 370
                      ..|||   :|..||....:|.|..:|:...:|      .|..|..|.|:.:...:
  Fly  1002 AIGQLQSHKFRHLPHRSFKCLTCGGEFVRKQMFFKHLNRDTN------RCDNRPHREFDDDEPDQ 1060

  Fly   371 AVHLK-LKPFPCHHCPESFA--SRKTLRHH----------EYIH---TGEKPYICDTCGQAF--R 417
            ...|. :....|..|.::|.  ::|..|.|          |.:|   .||..|.|..|.:..  .
  Fly  1061 DTLLSTIYHLTCPQCGDNFKTHNKKEWREHINDHHGLTKLELLHMTKVGEDVYRCQDCDEELETN 1125

  Fly   418 QQTCLKNHRKVH 429
            :|..|:.||..|
  Fly  1126 RQWVLQFHRFQH 1137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 20/103 (19%)
C2H2 Zn finger 158..179 CDD:275368 7/26 (27%)
C2H2 Zn finger 188..209 CDD:275368 6/20 (30%)
C2H2 Zn finger 218..239 CDD:275368 7/22 (32%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
C2H2 Zn finger 294..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 4/20 (20%)
C2H2 Zn finger 381..401 CDD:275368 7/31 (23%)
C2H2 Zn finger 409..429 CDD:275368 6/21 (29%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368 5/20 (25%)
C2H2 Zn finger 557..580 CDD:275368 4/22 (18%)
C2H2 Zn finger 589..609 CDD:275368 5/19 (26%)
COG5236 <939..>1096 CDD:227561 29/162 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.