DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG8478

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001163576.1 Gene:CG8478 / 41194 FlyBaseID:FBgn0037746 Length:576 Species:Drosophila melanogaster


Alignment Length:431 Identity:80/431 - (18%)
Similarity:135/431 - (31%) Gaps:120/431 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KEPLKTELQSDEIPIS-----QELQQLLNINLSQDVENQDADQQWL-PNELCLECRSAVQNFEKF 81
            :|..||...|...|:|     :.:.::.|..:|..|....|:::.. .||:..|....:....|.
  Fly   186 QEAAKTPAPSQVYPLSANVVLENITEVSNEGVSMLVSPAGAEKEVAHVNEVVNEVSELIAKALKI 250

  Fly    82 RRKADECR----KQLLEMLKKDPREPTFEVVYDGREEDQESLHGLEPPEPAPDPDPIDEPAIKSD 142
              .||..:    |..:|..||             |:....:..|...|.|.....|......::.
  Fly   251 --SADSVKPATSKLKVEAGKK-------------RQSMSSTYSGAALPRPRRSYLPTTTAETRTY 300

  Fly   143 KSPRKSFRGSRNTLKCSVCRRSFAHQITLAAH----IRKVHEGSKRPFQCDQCEKAYSFMGGLYT 203
            ...::.....:.||.....:||....::|:..    :.|:.:.|                     
  Fly   301 SFKQRMSVVVKTTLNSPARKRSVGGGVSLSRRSCLPVSKLTKSS--------------------- 344

  Fly   204 HIREVHAPKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQSANLK 268
             ||:..|....|.|      |:| .|:.|....|.:..        |.|.|:.|..:|...:.|.
  Fly   345 -IRKSLAVTSVRSP------EKI-ASKPAKTSTKSIPE--------KVFSCKNCSTTFRVKSLLD 393

  Fly   269 YHLKTKHPTED------EVAAREGGAG-ERHFCDICQKEFHSRYTLKYHTLQ------------- 313
            .|::...|.::      .:.:....|| .::.|..|.|.|.....|..|.:|             
  Fly   394 VHMRMHDPVDNGANTLKRLNSNPVAAGVSKNRCKFCDKNFALERALHIHLMQNCDKIPPSEKRKL 458

  Fly   314 -----QHEVQEELPHECQVCG--------RRMAKKFMLL---------QHMLMHSNDKLPCEHCG 356
                 .||.:.:||......|        ::..::...:         |.|...|..|:|     
  Fly   459 EFTELNHEKKAQLPKIGGTSGINHPMTMPQKPQQRISTIPKLAPSQGTQSMAPPSVKKIP----- 518

  Fly   357 RRFARRFELEAHVRAVHLKLKPFPCHHCPESFASRKTLRHH 397
                   :..||........|..|||.|.:||.|.....:|
  Fly   519 -------KNVAHAGVYRTPTKTVPCHICKQSFRSILEFTNH 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 17/81 (21%)
C2H2 Zn finger 158..179 CDD:275368 4/24 (17%)
C2H2 Zn finger 188..209 CDD:275368 2/20 (10%)
C2H2 Zn finger 218..239 CDD:275368 5/20 (25%)
C2H2 Zn finger 254..275 CDD:275368 5/20 (25%)
C2H2 Zn finger 294..315 CDD:275368 7/38 (18%)
C2H2 Zn finger 325..345 CDD:275368 3/36 (8%)
C2H2 Zn finger 352..373 CDD:275368 2/20 (10%)
C2H2 Zn finger 381..401 CDD:275368 7/17 (41%)
C2H2 Zn finger 409..429 CDD:275368
CG8478NP_001163576.1 zf-C2H2 377..399 CDD:278523 6/21 (29%)
C2H2 Zn finger 379..399 CDD:275368 5/19 (26%)
C2H2 Zn finger 426..444 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.