DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3032 and CG1024

DIOPT Version :9

Sequence 1:	NP_001284974.1	Gene:	CG3032 / 31648	FlyBaseID:	FBgn0029928	Length:	431	Species:	Drosophila melanogaster
Sequence 2:	NP_001138014.2	Gene:	CG1024 / 40789	FlyBaseID:	FBgn0027514	Length:	543	Species:	Drosophila melanogaster

Alignment Length:	130	Identity:	35/130 - (26%)
Similarity:	53/130 - (40%)	Gaps:	34/130 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   252 FICEQCGASFNQSANLKYHLKTKHPTEDEVAAREGGAGERHFCDICQKEFHSRYTLKYHTLQQHE 316
            :||.:||.:|...|..:.||.|||                   |..:|.:..     ::.:|
  Fly    28 YICPECGKAFRTQAEWRQHLNTKH-------------------DYLKKTYSD-----FNFIQ--- 65

  Fly   317 VQEELPHECQVCGR---RMAKKFMLLQ-HMLMH--SNDKLPCEHCGRRFARRFELEAHVRAVHLK 375
            :.|.. ||||:|.:   ...|...||| |..||  .::...|.||...:.||..|..|:...|::
  Fly    66 IDERF-HECQLCFKWVENAHKTIALLQYHYFMHLEHSETYRCVHCRMAYTRRRALNVHLLDTHMR 129

Fly 376 375
Fly 130 129

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3032	NP_001284974.1	zf-AD	13..95	CDD:285071
		C2H2 Zn finger	158..179	CDD:275368
		C2H2 Zn finger	188..209	CDD:275368
		C2H2 Zn finger	218..239	CDD:275368
		C2H2 Zn finger	254..275	CDD:275368	8/20 (40%)
		C2H2 Zn finger	294..315	CDD:275368	3/20 (15%)
		C2H2 Zn finger	325..345	CDD:275368	8/23 (35%)
		C2H2 Zn finger	352..373	CDD:275368	7/20 (35%)
		C2H2 Zn finger	381..401	CDD:275368
		C2H2 Zn finger	409..429	CDD:275368
CG1024	NP_001138014.2	C2H2 Zn finger	30..51	CDD:275368	8/20 (40%)
		C2H2 Zn finger	73..100	CDD:275368	10/26 (38%)
		C2H2 Zn finger	106..123	CDD:275368	6/16 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24409
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100