DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and Aef1

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001262157.1 Gene:Aef1 / 40370 FlyBaseID:FBgn0005694 Length:454 Species:Drosophila melanogaster


Alignment Length:294 Identity:72/294 - (24%)
Similarity:112/294 - (38%) Gaps:80/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 QITLAAHIRKVHEGSKRPFQCDQCEKAYSFMGGLYTHIREVHAPKERRH---------PCDQPGC 223
            |.|..||:..|.:..::..|..|                :.|..::::.         |.:.|..
  Fly    45 QATHPAHMAAVQQQQQQQQQQQQ----------------QHHQQQQQQSSGPPSVPPPPTELPLP 93

  Fly   224 ERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQS--------ANLKYHLKT------- 273
            .:::.|.|:.:.|...:.:..   |..:....|..|:..|.        .:|..|..|       
  Fly    94 FQMHLSGISAEAHSAAQAAAM---AAAQAAAAQAAAAEQQQPPPPTSHLTHLTTHSPTTIHSEHY 155

  Fly   274 ------KHPTEDEVAAREGGAGERHFCDICQKEFHSRYTLKYHTLQQHEVQE-ELPHECQVCGRR 331
                  :||.|...|...|||                            |:| |.|..|.||.||
  Fly   156 LANGHSEHPGEGNAAVGVGGA----------------------------VREPEKPFHCTVCDRR 192

  Fly   332 MAKKFMLLQHMLMHSNDK-LPCEHCGRRFARRFELEAHVRAVHLKLKPFPCHHCPESFASRKTLR 395
            ..:...|..|:.:|:.:| ..|..|.:.|.:...|..|:: :|...||:.|:.||:.|....||.
  Fly   193 FRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLK-IHTGEKPYNCNFCPKHFRQLSTLA 256

  Fly   396 HHEYIHTGEKPYICDTCGQAFRQQTCLKNHRKVH 429
            :|..|||||||:.|..|.:.|||.:.|.||.|:|
  Fly   257 NHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 4/10 (40%)
C2H2 Zn finger 188..209 CDD:275368 1/20 (5%)
C2H2 Zn finger 218..239 CDD:275368 4/20 (20%)
C2H2 Zn finger 254..275 CDD:275368 6/41 (15%)
C2H2 Zn finger 294..315 CDD:275368 0/20 (0%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
C2H2 Zn finger 409..429 CDD:275368 9/19 (47%)
Aef1NP_001262157.1 C2H2 Zn finger 186..206 CDD:275368 7/19 (37%)
zf-H2C2_2 199..223 CDD:290200 7/23 (30%)
C2H2 Zn finger 214..234 CDD:275368 5/20 (25%)
zf-H2C2_2 227..251 CDD:290200 9/24 (38%)
C2H2 Zn finger 242..262 CDD:275368 7/19 (37%)
zf-H2C2_2 255..279 CDD:290200 12/23 (52%)
C2H2 Zn finger 270..290 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2696
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.