DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG30020

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster


Alignment Length:671 Identity:117/671 - (17%)
Similarity:172/671 - (25%) Gaps:294/671 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PLNLTRESV----------RELCCTCLLQLEKEPLKTELQSDEIPISQELQQLLNINLSQDVENQ 56
            |.|.:..||          .::...|.:..:..|:   :..|:|.|...     ||:|..|.||.
  Fly   613 PANSSSVSVFGDMQDFIDNTDVAAICTIPADGMPV---VDGDDIVIDNN-----NISLDFDAENL 669

  Fly    57 DADQQWLPNELCLECRSAVQNFEKFRRKADECRKQLLEMLKKDPREPTFEVVYDGREEDQESLHG 121
                                 ||.|..:.|:....     ::|..:...|...:....||..|  
  Fly   670 ---------------------FEDFEEEEDDTVAD-----EEDEADNEDENDNNDAATDQNLL-- 706

  Fly   122 LEPPEPAPDPDPIDEPAIKSDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPF 186
                 ...|.|.:|:...:..|..:|.:        |..|.:.|..|.....|: .||.| ..|:
  Fly   707 -----LTSDDDDVDDFDDEQSKHLQKPY--------CIYCNKKFTSQYKFENHM-FVHRG-LAPY 756

  Fly   187 QCDQCEKAYSFMGGLYTHIREVHAPKERRHPCDQPG---------CERIYTSRI----------- 231
            :|:.|...|:....|..|.:.||.....|......|         .|::|..||           
  Fly   757 RCELCTNLYNMKRLLIKHYKTVHKRMPTRDMVQAKGDKVSVARTNIEKLYPGRIKNPMLMCAKCP 821

  Fly   232 -------AMQKHKRLKHSPRD---RDALKKFI-------CEQCGASFNQSANLKYHLKTKHPTE- 278
                   .|:||....|...|   ..|.:.||       |.:|..||.....|..||:..|..: 
  Fly   822 FECESDSEMRKHLNAHHGINDGVSEHANEVFIIRKLPFECPRCIRSFAAKTTLSRHLQRSHLVDT 886

  Fly   279 -----------------------------------------------------------DEVAAR 284
                                                                       :|....
  Fly   887 IIEMQTPHCGEAITTTMATSSSTISEPVNSVTVDGQHNEMMQTDVGAEKMTEALGNGDGNEEGGT 951

  Fly   285 EGGAGER---------------------------------------------------------- 291
            :.|.|.:                                                          
  Fly   952 DDGTGVKAEPAVPEEELDPVTLDAATAVTTTAIAAAISAAAAATATSLESPVATTASSSTTLFPT 1016

  Fly   292 ----------------------------------------------------------------- 291
                                                                             
  Fly  1017 PTPFDFDYDIMRDEAQQSSPNIHDVSKALSDNASSSCPINESYKLLSTTALETSPAKGLRSNSRL 1081

  Fly   292 -----HFCDICQKEFHSRYTLKYHTLQQHEVQEE----LPHECQVCGRRMAKKFMLLQHMLMHSN 347
                 |.|.:|.:.|.....|..|.::.|...|.    ..|:|.:|........:|..||..|||
  Fly  1082 HRSSIHICKLCNQTFDELGKLVKHEMELHSNTERSRWGYQHKCAICNTSYRTLTLLKFHMKRHSN 1146

  Fly   348 DKLPCEHCGRRFARRFELEAHVRAVHLKLKPFPC--HHCPESFASRKTL-RHHEYIHTGEKPYIC 409
            .|..|:.|.:.|....|||.|.:|.|.|.|...|  ..|.::||.:..| ||.:..|...: |||
  Fly  1147 RKSQCKLCPKSFVTIAELERHTKAKHSKDKTLRCFMDGCRKTFAFKHHLIRHQKASHLSTR-YIC 1210

  Fly   410 DTCGQAFRQQTCLKNHRKVHE 430
            ..|.:..:....||||..||:
  Fly  1211 PVCNKEEKSNVHLKNHMSVHK 1231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 15/81 (19%)
C2H2 Zn finger 158..179 CDD:275368 5/20 (25%)
C2H2 Zn finger 188..209 CDD:275368 5/20 (25%)
C2H2 Zn finger 218..239 CDD:275368 8/47 (17%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
C2H2 Zn finger 294..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 325..345 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..373 CDD:275368 8/20 (40%)
C2H2 Zn finger 381..401 CDD:275368 7/22 (32%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368 5/20 (25%)
C2H2 Zn finger 758..777 CDD:275368 5/18 (28%)
C2H2 Zn finger 1089..1110 CDD:275368 5/20 (25%)
C2H2 Zn finger 1124..1144 CDD:275368 5/19 (26%)
C2H2 Zn finger 1151..1172 CDD:275368 8/20 (40%)
C2H2 Zn finger 1180..1203 CDD:275368 7/22 (32%)
C2H2 Zn finger 1210..1230 CDD:275368 6/19 (32%)
C2H2 Zn finger 1238..1254 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.