DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and az2

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_610289.2 Gene:az2 / 35682 FlyBaseID:FBgn0025185 Length:593 Species:Drosophila melanogaster


Alignment Length:234 Identity:70/234 - (29%)
Similarity:103/234 - (44%) Gaps:25/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 PRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHE-GSKRPFQCDQCEKAYSFMGGLYTHIREV 208
            |.|||   |..|||.||..||:....|.||..:.|: |....|:|..||..:.....|..|.:.|
  Fly   367 PTKSF---RQKLKCEVCEHSFSTDHALQAHQFRDHKMGDGGWFRCTLCELNFDRKCHLQQHSQRV 428

  Fly   209 HAPKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQSANLKYHLKT 273
            |..|.  ..|:.  |.|.:.....:..||| .|.  ::...|.|:||.||..|.|...:..|:..
  Fly   429 HMDKS--FVCEI--CSRSFAFGNQLAIHKR-THD--EKHVAKPFVCEFCGKCFKQKIQMTTHVTA 486

  Fly   274 KHPTEDEVAAREGGAGERHFCDICQKEFHSRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFML 338
            .|   .::.|.:        ||:|.|:|.::..||.|......:::::   |:||.:.......|
  Fly   487 VH---TKIRAFK--------CDMCPKDFLTKRDLKDHVKAHLNIRDKV---CEVCQKAFTNANAL 537

  Fly   339 LQHMLMHSNDKLPCEHCGRRFARRFELEAHVRAVHLKLK 377
            ::|..:|....|.|..|..||:.|..|..|:|..|..||
  Fly   538 VKHRHIHKEKTLQCSLCTTRFSERVSLGVHMRRTHKILK 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 8/20 (40%)
C2H2 Zn finger 188..209 CDD:275368 5/20 (25%)
C2H2 Zn finger 218..239 CDD:275368 5/20 (25%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
C2H2 Zn finger 294..315 CDD:275368 8/20 (40%)
C2H2 Zn finger 325..345 CDD:275368 5/19 (26%)
C2H2 Zn finger 352..373 CDD:275368 8/20 (40%)
C2H2 Zn finger 381..401 CDD:275368
C2H2 Zn finger 409..429 CDD:275368
az2NP_610289.2 MADF_DNA_bdg 157..242 CDD:287510
GT1 276..>341 CDD:304916
C2H2 Zn finger 377..398 CDD:275368 8/20 (40%)
C2H2 Zn finger 408..429 CDD:275368 5/20 (25%)
C2H2 Zn finger 436..456 CDD:275368 6/22 (27%)
C2H2 Zn finger 467..488 CDD:275368 7/20 (35%)
C2H2 Zn finger 496..516 CDD:275368 8/19 (42%)
C2H2 Zn finger 524..544 CDD:275368 5/19 (26%)
C2H2 Zn finger 551..572 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.