DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG30431

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:458 Identity:114/458 - (24%)
Similarity:178/458 - (38%) Gaps:114/458 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCCTCLLQLEKEPLKTELQSDEIPISQELQQLLNINLSQDVENQDADQQWLPNELCLECRSAVQN 77
            |.|.|.| ||:.||...|......::.||:.|......:..:|       |.:.:|..|...:.:
  Fly    10 LVCRCCL-LEQPPLYHSLYDASSQLAVELKALAPALRLEHGDN-------LTDVICDLCLRRLHD 66

  Fly    78 FEKFRRKADECRKQLLEMLKKDPREPTFEV--------VYDGREEDQESLHG-----LEPPEP-- 127
            ...|:|:. |..:|:|.| :.:..:.|..|        |.:..|.:..||.|     |:..:|  
  Fly    67 ARDFQRRC-EHSEQVLRM-RHEHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPVA 129

  Fly   128 --APDPDPIDEPAIKSDKSPRKSF-----------RGSRNTLKCSVCRRSFAHQITLAAHIRKVH 179
              ||..:.:|..::....|.....           .||.||          .|.....|.:..|.
  Fly   130 HVAPLMETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNT----------PHHQPETAELFAVE 184

  Fly   180 -----EGSKRPFQCDQCEKAYSFMGGLYTHIREVHAPKERRHPCDQPGCERIYTSRIAMQKHKRL 239
                 |.|:.|.. |..||                 ||.||                |..:...:
  Fly   185 PPTPPESSEEPAP-DAAEK-----------------PKMRR----------------ARPRQDNV 215

  Fly   240 KHSPRDRDA------LKKFICEQCGASFNQSANLKYHLKTKHPTEDEVAAREGGAGE-RHFCDIC 297
            |  |::|.|      .....|.:|...|.::..||.|:...|           |.|| |:.|:.|
  Fly   216 K--PKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVH-----------GMGEMRYQCEEC 267

  Fly   298 QKEFHSRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHMLMHSNDKLP----CEHCGRR 358
            :|.|.||::|:||....|..  |.|..||.|.||...:..||.|:..|:.:..|    |:.|.:.
  Fly   268 RKNFASRHSLRYHVKSVHST--ERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKS 330

  Fly   359 FARRFELEAHVRAVHLKL-KPFPCHHCPESFASRKTLRHHEYIHTGEKPYICDTCGQAFRQQTCL 422
            :..:.:|..|:|:.:..: :||.|..|.::|.:|..|..|..:||||||:.|:.|.:.::....|
  Fly   331 WPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNL 395

  Fly   423 KNH 425
            .||
  Fly   396 NNH 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 21/81 (26%)
C2H2 Zn finger 158..179 CDD:275368 2/20 (10%)
C2H2 Zn finger 188..209 CDD:275368 3/20 (15%)
C2H2 Zn finger 218..239 CDD:275368 1/20 (5%)
C2H2 Zn finger 254..275 CDD:275368 6/20 (30%)
C2H2 Zn finger 294..315 CDD:275368 9/20 (45%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 5/17 (29%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 19/79 (24%)
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 9/20 (45%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
zf-C2H2_8 305..373 CDD:292531 18/67 (27%)
C2H2 Zn finger 324..344 CDD:275368 5/19 (26%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 10/22 (45%)
C2H2 Zn finger 382..403 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.