DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG12299

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster


Alignment Length:363 Identity:109/363 - (30%)
Similarity:157/363 - (43%) Gaps:79/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 DPRE--------PTFEVVYDGREEDQESLHGLEPPEPAPDPD--------------------PID 135
            ||||        ||..|.         .|..|.||.|...|.                    |:.
  Fly   188 DPRESTSIFMVQPTVSVT---------PLQQLLPPAPTVSPGLGLQSTPIKRRRGRRSNIGAPVM 243

  Fly   136 EPAIKSDKSPRKSFRGSRNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPFQCDQCEKAYSFMGG 200
            :||:          .|::...:|:.|..||.:...|:.|:|. |..:| ||||..|:|.::.:|.
  Fly   244 DPAL----------NGNQKCFQCTHCEASFPNAGDLSKHVRS-HITNK-PFQCSICQKTFTHIGS 296

  Fly   201 LYTHIREVHAPKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICEQCGASFNQSA 265
            |.|||| :|: .|:.:.|:.  |.:.:|...::..|.| .||.|     |...|.||...|...:
  Fly   297 LNTHIR-IHS-GEKPYKCEL--CPKAFTQSSSLMVHMR-SHSVR-----KPHQCVQCDKGFINYS 351

  Fly   266 NLKYHLKTKH--PTEDEVAAREGGAGERHFCDICQKEFHSRYTLKYHTLQQHEVQEELPHECQVC 328
            :|..|.|| |  |||..:            |..|::||.:...|..| ::.|  .:||.::|.:|
  Fly   352 SLLLHQKT-HIAPTETFI------------CPECEREFKAEALLDEH-MRMH--TQELVYQCAIC 400

  Fly   329 GRRMAKKFMLLQHMLMHSNDK-LPCEHCGRRFARRFELEAHVRAVHLKLKPFPCHHCPESFASRK 392
            .........|:|||..|..:| ..|..|.|.|.:...|..|:| :|...|||.|..|.:.|....
  Fly   401 REAFRASSELVQHMKNHMGEKPFTCSLCDRSFTQSGSLNIHMR-IHTGEKPFQCKLCDKCFTQAS 464

  Fly   393 TLRHHEYIHTGEKPYICDTCGQAFRQQTCLKNHRKVHE 430
            :|..|..||.|||||.|..||:::.||..|..|.:.|:
  Fly   465 SLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHIQAHQ 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 7/20 (35%)
C2H2 Zn finger 188..209 CDD:275368 9/20 (45%)
C2H2 Zn finger 218..239 CDD:275368 4/20 (20%)
C2H2 Zn finger 254..275 CDD:275368 8/20 (40%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 5/19 (26%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 56/186 (30%)
C2H2 Zn finger 256..276 CDD:275368 7/20 (35%)
zf-H2C2_2 268..293 CDD:290200 11/26 (42%)
C2H2 Zn finger 284..304 CDD:275368 9/20 (45%)
zf-H2C2_2 296..321 CDD:290200 9/28 (32%)
zf-C2H2_2 312..>387 CDD:289522 27/96 (28%)
C2H2 Zn finger 312..332 CDD:275368 5/22 (23%)
C2H2 Zn finger 340..360 CDD:275368 8/20 (40%)
C2H2 Zn finger 369..389 CDD:275368 6/20 (30%)
C2H2 Zn finger 397..417 CDD:275368 6/19 (32%)
zf-H2C2_2 409..434 CDD:290200 10/24 (42%)
C2H2 Zn finger 425..445 CDD:275368 7/20 (35%)
zf-H2C2_2 437..462 CDD:290200 10/25 (40%)
C2H2 Zn finger 453..473 CDD:275368 5/19 (26%)
zf-H2C2_2 465..490 CDD:290200 12/24 (50%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.