DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG1529

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:476 Identity:110/476 - (23%)
Similarity:173/476 - (36%) Gaps:141/476 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TRESVRELCCTCLLQLEKEPLKTELQSDEIPISQELQQLLNINLSQDVENQDADQQWLPNELCLE 70
            |...:..||..||..|...    :....:..:...||:||:|::.:....       .|.|:|..
  Fly     4 TFTDLARLCRICLRHLRDR----DTHCPDPRLIAILQKLLDIDILKQPHG-------FPTEICNL 57

  Fly    71 CRSAVQNFEKFRRKADECRKQLLEMLKKD------PREPTFEVVYDGREEDQESLHGLEPPEPAP 129
            |.:||..|::.|:.|.|..::|:.....|      ..||..|.:.:..||::..|.  |..|...
  Fly    58 CHNAVVYFDELRQVARESSQKLIGWQPVDIAVDRVKEEPPDEGLKENHEENEHELE--EEHEKQA 120

  Fly   130 DPDPI-------DEPAIKSDK-----------SPRKSFRGS----RNTLKCSVCRRSFAHQITLA 172
            |...:       |:..|..|:           |.::..:|:    |..|.|..|.:.......|.
  Fly   121 DGQQVDLSKKQEDQKKILDDREDEEYPDEYENSQQQLSQGTGSKRRAGLACDQCGKQVYKLPYLE 185

  Fly   173 AHIRKVHEGSKRPFQCDQCEKAYSFMGGLYTHIREVHAPKERRHPCDQPGCERIYTSRIAMQKHK 237
            ||||.||:|..:||.|..|:|:::....|.:|:|..|           |..|::           
  Fly   186 AHIRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAH-----------PQLEQL----------- 228

  Fly   238 RLKHSPRDRDALKKFICEQCGASFNQSANLKYHLKTKHPTEDEVAAREGGAGERHFCDICQKEFH 302
                    :..|:..|||.|...::....|..|||                              
  Fly   229 --------QQELRDLICELCNRQYSTKNALGEHLK------------------------------ 255

  Fly   303 SRYTLKYHTLQQHEVQEELPHECQVCGRRMAKKFMLLQHMLMHSN--DKLPCEHCGRRFARRFEL 365
                       :|..::|  |.|:.||.....:..||.|:..|:.  ::..||.|.:.|..:..:
  Fly   256 -----------RHAQRKE--HVCEHCGVAKVTRTELLTHLRTHNPTWERFKCEQCPQLFRHKSAI 307

  Fly   366 EAHVRAVHLKLKPFPCHHCPESFASRKTLRHHEYIHT-----GEK----PYICDTCGQAFRQQTC 421
            ..|||.||...:.|.|.||.:.|.:..:...||.:||     ||.    |:.|..|     |:.|
  Fly   308 SRHVRVVHEGQRRFQCGHCEKKFGTHASQVRHERLHTESTGSGEAAEEWPFACIHC-----QKPC 367

  Fly   422 ---------LKNH--RKVHEK 431
                     |:.|  ||.|.|
  Fly   368 VSRQTLELHLRRHRARKTHRK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071 21/81 (26%)
C2H2 Zn finger 158..179 CDD:275368 7/20 (35%)
C2H2 Zn finger 188..209 CDD:275368 6/20 (30%)
C2H2 Zn finger 218..239 CDD:275368 2/20 (10%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
C2H2 Zn finger 294..315 CDD:275368 0/20 (0%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..373 CDD:275368 7/20 (35%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 8/30 (27%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 20/78 (26%)
C2H2 Zn finger 171..192 CDD:275368 7/20 (35%)
zf-C2H2_2 201..>257 CDD:289522 18/126 (14%)
C2H2 Zn finger 201..222 CDD:275368 6/20 (30%)
C2H2 Zn finger 237..257 CDD:275368 7/60 (12%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-C2H2_8 268..349 CDD:292531 24/80 (30%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 360..380 CDD:275368 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.