DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3032 and CG7101

DIOPT Version :9

Sequence 1:NP_001284974.1 Gene:CG3032 / 31648 FlyBaseID:FBgn0029928 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_573329.2 Gene:CG7101 / 32875 FlyBaseID:FBgn0030963 Length:352 Species:Drosophila melanogaster


Alignment Length:366 Identity:75/366 - (20%)
Similarity:121/366 - (33%) Gaps:123/366 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 EPAIKSDKSPRKSFRGS----------RNTLKCSVCRRSFAHQITLAAHIRKVHEGSKRPFQCDQ 190
            ||.....|:|..|.||:          :.|..|.||...|:..:....|.::.....:|.|.|  
  Fly     2 EPVPIRPKAPGASNRGALPLAAKKPAKKRTYHCGVCFAEFSRHLAAKRHEQQCSVRVRRLFVC-- 64

  Fly   191 CEKAYSFMGGLYTHIREVHAPKERRHPCDQPGCERIYTSRIAMQKHKRLKHSPRDRDALKKFICE 255
                                          |.|..::.....:::|:..||:.      .:|:|.
  Fly    65 ------------------------------PHCLTLFGEEARLERHRERKHND------GQFLCL 93

  Fly   256 QCGASFNQSANLKYHLKTKHPTEDEVAAREGGAGERHFCDICQ------KEFHSRYTLKYHTLQQ 314
            |||..:..:..|..|:.:.|           |.....:||:|.      |.|.....|:.|..:.
  Fly    94 QCGKKYASATFLYRHVASWH-----------GQQSLFYCDMCTDNCNDVKTFSGMLELQEHAEEV 147

  Fly   315 H----------------------EVQEE-----LP-----------------------------H 323
            |                      |:.||     ||                             .
  Fly   148 HRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFGWPTDLDKESCIVNAKPSVF 212

  Fly   324 ECQVCGRRMAKKFMLLQHM-LMHSNDKLPCEHCGRRFARRFELEAHVRAVHLKLKPFPCHHCPES 387
            .|..|.........|::|: .:|....|.|.:||:....|..|.:|::.||:.|:...|..|...
  Fly   213 VCPFCANGFPGSLSLVRHLEQVHERSALDCCYCGKSHGSREALRSHLQRVHILLRGHVCGICQAD 277

  Fly   388 FASRKTLRHH-EYIHTGEKPYICDTCGQAFRQQTCLKNHRK 427
            ||:...|:.| ..:|...:|::|.|||:.|.|:..|.:|.|
  Fly   278 FATADHLKKHVNSLHLDHRPHLCPTCGKRFTQRCHLTDHIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3032NP_001284974.1 zf-AD 13..95 CDD:285071
C2H2 Zn finger 158..179 CDD:275368 5/20 (25%)
C2H2 Zn finger 188..209 CDD:275368 1/20 (5%)
C2H2 Zn finger 218..239 CDD:275368 3/20 (15%)
C2H2 Zn finger 254..275 CDD:275368 6/20 (30%)
C2H2 Zn finger 294..315 CDD:275368 7/26 (27%)
C2H2 Zn finger 325..345 CDD:275368 4/20 (20%)
C2H2 Zn finger 352..373 CDD:275368 6/20 (30%)
C2H2 Zn finger 381..401 CDD:275368 6/20 (30%)
C2H2 Zn finger 409..429 CDD:275368 9/19 (47%)
CG7101NP_573329.2 PHA00733 <210..263 CDD:177301 12/52 (23%)
C2H2 Zn finger 242..263 CDD:275368 6/20 (30%)
C2H2 Zn finger 271..292 CDD:275368 6/20 (30%)
C2H2 Zn finger 300..319 CDD:275368 9/19 (47%)
C2H2 Zn finger 330..347 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.